{"title":"Keepsake Baby Blankets","description":"\u003cp dir=\"ltr\"\u003e\u003cspan\u003eSome gifts are opened, admired, and forgotten. Our keepsake baby blankets are made to become part of a child’s everyday life and the family memories around it. This collection brings together the softness of a receiving blanket with the emotional pull of a real keepsake. If you are searching for keepsake blankies that feel suitable for a christening, baby shower, welcome-home gift, or first birthday, these styles are designed to feel both useful and sentimental from the beginning.\u003c\/span\u003e\u003c\/p\u003e\n\u003ch2 dir=\"ltr\"\u003e\u003cspan\u003eKeepsake Blankies With a More Heirloom Feel\u003c\/span\u003e\u003c\/h2\u003e\n\u003cp dir=\"ltr\"\u003e\u003cspan\u003eWhat makes this style different is the balance between beauty and practicality. These personalised keepsake blankets have the gentle, classic look families often want in a nursery keepsake, while still being light enough for regular snuggles. That heirloom quality is what makes them stand out as a meaningful newborn gift rather than just another blanket on the pile.\u003c\/span\u003e\u003c\/p\u003e","products":[{"product_id":"bryce-camper-keepsake-blankie","title":"Keepsake Baby Blanket – Personalized Soft Satin Trim Baby Camping Blanket 39x29","description":"\u003cp\u003eThe Bryce Canyon Campers Keepsake Blankie is a keepsake baby blanket designed to wrap your little one in warmth and memories from your favorite outdoor adventures. Crafted from a thick, luxurious blend of 86% polyester, 12% rayon, and 2% spandex, this personalized baby blanket offers both comfort and durability for your infant’s delicate skin. Measuring 39\" tall by 43\" wide, it is the perfect size for swaddling or cuddling, making it an ideal baby boy keepsake or newborn comforter that preserves the magic of family camping trips.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis soft satin trim blanket features a smooth satin edge that enhances softness and prevents fraying, ensuring lasting quality through countless washes. The machine washable blankie maintains vibrant colors and softness without fading, providing a practical solution for busy parents who want both style and ease of care. Personalize this custom name blanket with one or two names to create a unique baby gift idea that celebrates your child’s connection to nature and cherished moments.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Made with thick, luxurious material (86% Polyester, 12% Rayon, 2% Spandex) → ensures warmth and durability\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin-trimmed edges → add softness and prevent fraying\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size: 39\" tall by 43\" wide → perfect for swaddling or cuddling\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized with one or two names → creates a meaningful keepsake\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable → easy care without fading or shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Inspired by Bryce Canyon camping trips → connects your baby to nature’s beauty\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis receiving blanket soft enough for newborn skin yet durable enough for everyday use serves as an infant cuddle blanket during naps or nighttime. Its versatile design doubles as a baby camping blanket for outdoor family outings or as a cozy throw in the nursery. Parents love how this luxury baby blankie combines sentimental value with practical features, making it a beloved addition to any baby's essentials.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether you’re looking for a special personalized baby blanket to commemorate your child’s first camping adventure or a reliable infant comforter to soothe them at home, the Bryce Canyon Campers Keepsake Blankie delivers on all fronts. AGreatBaby stands behind this product with quality craftsmanship and customer satisfaction, ensuring you receive a premium keepsake that lasts through years of use and memories.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580843176186,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580843208954,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580843274490,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348041466,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/bryce-canyon-campers-keepsake-blankie-2.jpg?v=1657308303"},{"product_id":"gray-mudcloth-keepsake-blankie","title":"Gray Mudcloth Blanket - Personalized Baby Swaddle Wrap With Satin Trim","description":"\u003cp\u003eThe Gray Mudcloth Blanket is a soft baby wrap designed to keep your little one cozy and secure while showcasing a stylish boho baby blanket pattern. This personalized baby blanket features a keepsake swaddle wrap crafted from luxury swaddle fabric that measures 39” x 29”, perfect for swaddling newborns or using as a receiving blanket. The gray mudcloth blanket offers a gender neutral blanket option, making it an ideal baby shower gift that combines function and style.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMade from a high-quality blend of 86% polyester, 12% rayon, and 2% spandex, this machine washable blanket ensures lasting softness and durability. The satin trim blanket adds a smooth touch against delicate skin while preventing fraying over time. Personalize it with one or two names to create a truly custom name blanket that will be cherished for years to come.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of the Gray Mudcloth Blanket include:\u003c\/p\u003e\u003cp\u003e- Thick and luxurious material blend for warmth and comfort\u003c\/p\u003e\u003cp\u003e- Satin trim that enhances softness and longevity\u003c\/p\u003e\u003cp\u003e- Generous size of 39” x 29” suitable for swaddling or as a receiving blanket\u003c\/p\u003e\u003cp\u003e- Personalization available with one or two names for a unique keepsake\u003c\/p\u003e\u003cp\u003e- Machine washable fabric that resists fading and maintains quality\u003c\/p\u003e\u003cp\u003e- Gender neutral design perfect for any nursery style\u003c\/p\u003e\u003cp\u003e- Stylish boho baby blanket print for modern parents\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby swaddle blanket has been tested to maintain its shape and color after multiple washes, ensuring it remains a reliable soft baby wrap throughout your child’s early months. Whether used as a swaddling \u0026amp; receiving blanket or gifted at a baby shower, the Gray Mudcloth Blanket combines practical use with elegant design. Trust AGreatBaby’s commitment to quality with every stitch in this personalized keepsake swaddle wrap.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eExplore more about choosing the right blankets for your newborn at https:\/\/agreatbaby.com\/pages\/what-type-of-blanket-do-i-want. Invest in a machine washable blanket that grows with your child, offering comfort, style, and sentimental value all in one.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841570554,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580841603322,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841668858,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348696826,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/gray-mudcloth-keepsake-blankie-1.jpg?v=1623552305"},{"product_id":"the-great-outdoors-keepsake-blankie","title":"Personalized Baby Swaddle | Keepsake Baby Receiving Blanket With Satin Trim","description":"\u003cp\u003eThe Great Outdoors Keepsake Blankie is a personalized baby swaddle designed to keep your little adventurer cozy while creating lasting memories. This personalized baby swaddle features iconic nature prints that make it a perfect baby photo backdrop, helping you announce your baby's arrival in style. Crafted from a soft polyester blanket blend (86% Polyester, 12% Rayon, 2% Spandex), it measures 39\" tall by 43\" wide to comfortably wrap your infant in warmth and comfort.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis luxury baby blanket offers a satin trim blanket finish that adds elegance and softness against delicate skin. It functions as both a swaddling blanket and a baby receiving blanket, providing versatile use from newborn days through toddlerhood. The keepsake baby blanket is personalized with one or two names, making it an ideal baby shower gift that stands out.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of The Great Outdoors Keepsake Blankie include:\u003c\/p\u003e\u003cp\u003e- Personalized baby swaddle with custom name embroidery for a unique touch\u003c\/p\u003e\u003cp\u003e- Soft polyester blend fabric that ensures gentle comfort and durability\u003c\/p\u003e\u003cp\u003e- Satin trim blanket edges that prevent irritation and enhance style\u003c\/p\u003e\u003cp\u003e- Generous 39\" tall by 43\" wide size to fully wrap and soothe your infant\u003c\/p\u003e\u003cp\u003e- Machine washable swaddle that maintains vibrant nature print colors without fading\u003c\/p\u003e\u003cp\u003e- Nature print swaddle design featuring iconic outdoor images perfect for memorable photos\u003c\/p\u003e\u003cp\u003e- Functions as an infant swaddle wrap and baby receiving blanket for multiple uses\u003c\/p\u003e\u003cp\u003e- Luxury baby blanket quality that withstands frequent washing and daily wear\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis keepsake blankie has been tested for colorfastness to ensure the beautiful nature prints stay vibrant wash after wash. Parents love how easily it cleans in the machine while still feeling soft against their baby's skin. It’s recommended by AGreatBaby as a top choice for both gifting and everyday use.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether you are looking for a practical swaddling blanket or a charming custom baby blanket to treasure, The Great Outdoors Keepsake Blankie combines function and style effortlessly. Its durable yet soft materials provide comfort while the personalized name feature makes it truly special. Use it as your go-to infant swaddle wrap or as an eye-catching baby photo backdrop that highlights your child’s unique personality.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose this satin trim blanket to give your newborn the warmth they need with the added benefit of beautiful nature-inspired designs. Perfect for play dates, outings, or quiet nap times, this keepsake baby blanket will become a beloved part of your baby's early years.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580843045114,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580843077882,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580843143418,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348762362,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/the-great-outdoors-keepsake-blankie-1.jpg?v=1623552485"},{"product_id":"colleen-floral-blue-keepsake-blankie","title":"Keepsake Blankie – Personalized Blue Floral Baby Swaddle Blanket with Satin Trim","description":"\u003cp\u003eThe Colleen Floral Blue Keepsake Blankie is a beautifully crafted keepsake blankie designed to wrap your baby girl in comfort and style. This personalized baby blanket features delicate blue wildflowers scattered around your baby's name, making it a unique floral keepsake blanket that doubles as a soft newborn swaddle and a charming newborn photo blanket. Measuring 39\" tall by 43\" wide, this luxury baby blanket is made from a thick blend of 86% polyester, 12% rayon, and 2% spandex, offering both durability and plush softness to keep your little one cozy and secure.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby swaddle blanket is satin-trimmed for added elegance, making it perfect for everyday use or special moments like newborn photography sessions. The personalized aspect allows you to add one or two names, creating a truly special baby girl blanket that will be treasured for years. Tested for quality, the fabric remains vibrant and soft even after multiple washes, ensuring this machine washable blanket stays fresh without fading.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of the Colleen Floral Blue Keepsake Blankie include:\u003c\/p\u003e\u003cp\u003e- Personalized baby blanket with one or two names embroidered\u003c\/p\u003e\u003cp\u003e- Soft newborn swaddle crafted from 86% polyester, 12% rayon, and 2% spandex for ultimate comfort\u003c\/p\u003e\u003cp\u003e- Satin trim blanket adds a luxurious touch and durability\u003c\/p\u003e\u003cp\u003e- Generous size of 39\" tall by 43\" wide suitable for swaddling and receiving\u003c\/p\u003e\u003cp\u003e- Machine washable blanket that maintains color and softness after washing\u003c\/p\u003e\u003cp\u003e- Durable baby blanket designed for everyday use and long-lasting quality\u003c\/p\u003e\u003cp\u003e- Perfect floral keepsake blanket with blue wildflower design ideal for newborn photo blanket use\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby receiving blanket blends style with function: the thick material provides warmth while remaining breathable to prevent overheating. The satin trim enhances durability while adding a smooth finish that feels gentle against delicate skin. Parents appreciate how easy it is to care for this machine washable blanket, making it a practical choice for busy families without sacrificing luxury.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eAGreatBaby stands behind the quality of every product with rigorous testing to ensure safety and performance. The Colleen Floral Blue Keepsake Blankie is more than just a swaddle—it's a keepsake that captures precious early moments while providing comfort that lasts. Whether used as a baby swaddle or a decorative piece in your nursery, this personalized keepsake blankie becomes an heirloom your family will cherish.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eDiscover the perfect blend of softness, personalization, and style with this blue floral blanket designed specifically for your baby's comfort and your peace of mind. For more information on choosing the right blankets for your little one, visit our guide at https:\/\/agreatbaby.com\/pages\/what-type-of-blanket-do-i-want.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840390906,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840423674,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840489210,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348958970,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/colleen-floral-blue-keepsake-blankie-4.jpg?v=1633116921"},{"product_id":"colleen-floral-mauve-keepsake-blankie","title":"Keepsake Blankie – Personalized Floral Baby Blanket With Satin Trim Swaddle","description":"\u003cp\u003eThe Colleen Floral Mauve Keepsake Blankie is a beautifully crafted keepsake blankie designed to wrap your baby in luxurious softness while providing comfort and security. This personalized baby blanket features delicate mauve wildflowers scattered around your baby's name, making it a standout floral baby blanket perfect for everyday use and newborn photo props. Measuring 39\" tall by 43\" wide, this soft newborn blanket is made from a premium blend of 86% polyester, 12% rayon, and 2% spandex, ensuring durability and gentle touch on your baby's skin. The satin trim blanket adds an elegant finish that enhances its luxury baby swaddle appeal. Machine washable and fade-resistant, this receiving blanket maintains its vibrant pink floral swaddle design even after multiple washes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis swaddle blanket offers multiple benefits:\u003c\/p\u003e\u003cp\u003e- Personalized with one or two names → creates a unique keepsake that celebrates your little one\u003c\/p\u003e\u003cp\u003e- Thick, luxurious material → provides warmth and comfort for newborns\u003c\/p\u003e\u003cp\u003e- Satin trim finish → adds softness and a polished look\u003c\/p\u003e\u003cp\u003e- Machine washable fabric → ensures easy care without fading or shrinking\u003c\/p\u003e\u003cp\u003e- Perfect size (39\" tall by 43\" wide) → ideal for swaddling, cuddling, or as a newborn photo prop\u003c\/p\u003e\u003cp\u003e- Durable construction → withstands daily use while maintaining quality\u003c\/p\u003e\u003cp\u003e- Versatile use → excellent as a baby shower gift or receiving blanket\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eCrafted by AGreatBaby, a trusted vendor known for quality baby products, this keepsake blankie combines style and function to deliver an exceptional experience for both parents and babies. The fabric blend was tested to meet safety standards for infant products, ensuring peace of mind with every use. Whether you are looking for a personalized baby gift or a practical yet beautiful swaddle blanket, the Colleen Floral Mauve Keepsake Blankie is designed to exceed expectations.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eCelebrate your baby's early days with this soft newborn blanket that doubles as a cherished memory piece. Its pink floral swaddle pattern brightens any nursery while the satin trim adds a touch of elegance. Ideal as a receiving blanket or a thoughtful baby shower gift, this keepsake blankie is more than just a cover—it’s a lasting treasure. Discover all the benefits of our blankets at [https:\/\/agreatbaby.com\/pages\/what-type-of-blanket-do-i-want] and give your baby the comfort they deserve.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841734394,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580841767162,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841832698,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348827898,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/colleen-floral-mauve-keepsake-blankie-5.jpg?v=1633117002"},{"product_id":"pattis-rich-floral-keepsake-blankie","title":"Personalized Baby Blanket – Fall Floral Keepsake Swaddle Blanket with Satin Trim","description":"\u003cp\u003ePatti's Fall Floral Keepsake Blankie is a personalized baby blanket designed to wrap your little one in warmth and comfort while celebrating the beauty of autumn. This luxury baby blanket features vibrant fall floral patterns on an ivory background, creating a cozy and rich feel that makes it the perfect newborn floral wrap. Crafted from a soft polyester blend (86% Polyester, 12% Rayon, 2% Spandex), this personalized baby blanket offers both softness and durability, ensuring long-lasting use and comfort for your baby.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThe satin trim blanket adds a smooth, elegant touch that enhances the keepsake quality of this swaddle blanket. Measuring 39\" tall by 43\" wide, it provides ample coverage for swaddling or as a baby receiving blanket during naps or stroller rides. Personalized with one or two custom names, this autumn baby blanket becomes a treasured heirloom that captures special memories and milestones.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis machine washable blanket maintains its vibrant colors and softness even after repeated washes, making it as practical as it is beautiful. AGreatBaby blankets are known for exceptional quality and attention to detail, backed by satisfied parents who trust their newborns with these premium products.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features:\u003c\/p\u003e\u003cp\u003e- Personalized baby blanket with one or two custom names for a unique keepsake\u003c\/p\u003e\u003cp\u003e- Soft polyester blend (86% Polyester, 12% Rayon, 2% Spandex) ensures gentle touch and durability\u003c\/p\u003e\u003cp\u003e- Satin trim blanket adds smoothness and elegance to the design\u003c\/p\u003e\u003cp\u003e- Generous size of 39\" tall by 43\" wide ideal for swaddling or receiving needs\u003c\/p\u003e\u003cp\u003e- Machine washable blanket retains color and texture wash after wash\u003c\/p\u003e\u003cp\u003e- Vibrant fall floral blanket design captures the essence of autumn\u003c\/p\u003e\u003cp\u003e- Keepsake swaddle perfect for newborns and toddlers alike\u003c\/p\u003e\u003cp\u003e- Luxury baby blanket crafted by trusted vendor AGreatBaby\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis fall floral blanket is more than just a swaddle—it’s a symbol of warmth and love during your baby's earliest days. The custom name blanket feature makes it an ideal gift for baby showers or first birthdays, combining practicality with sentimental value. The soft polyester material ensures breathability while keeping your infant snug.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eParents appreciate this baby receiving blanket not only for its charming design but also for its easy care. The satin trim prevents fraying, extending the life of this autumn baby blanket. Whether used as a newborn floral wrap or a cozy lap cover, it delivers comfort and style seamlessly.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose Patti's Fall Floral Keepsake Blankie to give your child a personalized touch of autumn warmth that lasts through years of cuddles and memories.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580842782970,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842815738,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842881274,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348205306,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/7b50ae56b4bc264fb84a26a1b35cbc042c256f9e.jpg?v=1761426943"},{"product_id":"plum-perfect-keepsake-blankie","title":"Plum Perfect Blankie - Personalized Baby Swaddle Blanket With Satin Trim Wrap","description":"\u003cp\u003eThe Plum Perfect Keepsake Blankie is a plush keepsake blankie designed to wrap your baby in warmth and comfort while providing a soft fall baby blanket perfect for autumn days. This purple swaddle wrap offers a cozy, luxurious baby wrap experience that soothes your little one during naps and playtime. Crafted from a blend of 86% polyester, 12% rayon, and 2% spandex, this baby swaddle blanket measures 39” x 29”, giving ample coverage for infants and toddlers. The satin trim blanket detail adds elegance and a smooth touch against delicate skin. Personalize this custom name blanket with one or two names to create a cherished keepsake that celebrates your child uniquely. This machine washable blanket maintains its vibrant color and softness wash after wash, making it a practical choice for busy parents.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of the Plum Perfect Keepsake Blankie include:\u003c\/p\u003e\u003cp\u003e- Plush keepsake blankie made from thick, luxurious fabric for lasting comfort\u003c\/p\u003e\u003cp\u003e- Satin-trimmed edges that provide a gentle feel and refined look\u003c\/p\u003e\u003cp\u003e- Size of 39” x 29” ideal for infant receiving blanket use and toddler swaddling\u003c\/p\u003e\u003cp\u003e- Personalized baby blanket option with one or two names embroidered\u003c\/p\u003e\u003cp\u003e- Machine washable blanket that resists fading and holds softness over time\u003c\/p\u003e\u003cp\u003e- Autumn baby blanket design featuring rich purple tones that complement fall colors\u003c\/p\u003e\u003cp\u003e- Suitable as a girls swaddle blanket or for any infant needing cozy warmth\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis soft fall baby blanket is perfect for wrapping your newborn in snug comfort or spreading out during playtime. The blend of materials ensures breathability and stretch, allowing freedom of movement while keeping your baby secure. Parents trust AGreatBaby products for their quality; this keepsake blankie comes with a satisfaction guarantee to ensure you love the product as much as your child will.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eUse it as an infant receiving blanket during swaddling or as a comforting cover throughout the day. The satin trim blanket enhances durability while adding softness to sensitive skin. Whether you are looking for a personalized baby blanket gift or a reliable purple swaddle wrap for daily use, the Plum Perfect Keepsake Blankie combines style, function, and sentimentality in one beautiful package.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose this luxurious baby wrap to celebrate every moment with your little princess. Its machine washable fabric makes cleanup easy without sacrificing quality or color vibrancy. This custom name blanket is an ideal heirloom piece that grows with your child, preserving memories wrapped in warmth and love throughout the seasons.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580842258682,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842291450,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842356986,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348729594,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/plum-perfect-keepsake-blankie-1.jpg?v=1623552971"},{"product_id":"sidney-alexandra-keepsake-blanket-1","title":"Keepsake Baby Blanket - Personalized Floral Baby Girl Blanket With Satin Trim","description":"\u003cp\u003eThe Sidney Alexandra keepsake baby blanket is a beautifully crafted floral baby blanket designed to wrap your baby girl in warmth and comfort while creating lasting memories. This luxurious baby throw features a soft newborn blanket material blend of 86% polyester, 12% rayon, and 2% spandex, providing gentle softness and durability. Measuring 39\" tall by 43\" wide, this custom name blanket is personalized with one or two names, making it a unique infant comforter that will be treasured for years. The satin trim blanket adds an elegant touch while ensuring a smooth finish that is gentle on delicate skin. Machine washable and fade-resistant, this baby receiving blanket offers convenience for busy parents without compromising quality or style.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThe Sidney Alexandra keepsake baby blanket combines modern design with timeless appeal, perfect as a baby swaddle blanket or cozy cover during naps and outings. Parents love how this personalized baby blanket creates a special bond with their little one, enhancing the newborn experience.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003e- Made from thick, luxurious material blend (86% Polyester, 12% Rayon, 2% Spandex) → ensures softness and durability\u003c\/p\u003e\u003cp\u003e- Satin-trimmed edges → provide a smooth, elegant finish\u003c\/p\u003e\u003cp\u003e- Size: 39\" tall by 43\" wide → ideal for swaddling or cuddling\u003c\/p\u003e\u003cp\u003e- Personalized with one or two names → creates a unique keepsake\u003c\/p\u003e\u003cp\u003e- Machine washable and fade-resistant → easy to clean and maintain\u003c\/p\u003e\u003cp\u003e- Suitable as a baby swaddle blanket, infant comforter, or receiving blanket\u003c\/p\u003e\u003cp\u003e- Modern floral design → complements any nursery decor\u003c\/p\u003e\u003cp\u003e- Trusted vendor AGreatBaby → known for quality and customer satisfaction\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis soft newborn blanket has been crafted to meet the needs of both babies and parents. The satin trim prevents irritation while the breathable fabric keeps your infant comfortable year-round. The custom name blanket feature makes it an exceptional gift for baby showers, birthdays, or welcoming a new arrival. Its machine washable fabric maintains vibrant colors and softness wash after wash.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoosing the Sidney Alexandra keepsake baby blanket means investing in a product that blends style, comfort, and personalization. It is not just any baby receiving blanket but a meaningful infant comforter that celebrates your baby's early days with warmth and elegance.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eExplore all our blankets at AGreatBaby to find the perfect match for your nursery needs.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580843438330,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580843471098,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580843536634,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348008698,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/A_GREAT_BABY__SID_JAN_2020110.jpg?v=1772651910"},{"product_id":"jeff-the-pilot-keepsake-blankie","title":"Keepsake Baby Blanket – Personalized Airplane Baby Blanket with Satin Trim","description":"\u003cp\u003eThe Jeff the Pilot Keepsake Blankie is the perfect keepsake baby blanket designed to provide your newborn with unmatched comfort and security. This personalized baby blanket offers a soft, stretchy fabric that wraps your little one in warmth while encouraging restful sleep and peaceful cuddles. Crafted to be a newborn soft blanket, it delivers lasting durability and gentle care for your baby's delicate skin, making it an ideal baby shower gift or everyday essential.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMade from a premium blend of 86% polyester, 12% rayon, and 2% spandex, this luxury baby blanket features a satin trim that adds elegance and softness against your infant’s skin. Measuring 39\" tall by 43\" wide, this baby receiving blanket is generously sized to swaddle your infant comfortably or to use as a cozy baby comforter. The stretchy baby blanket material allows for easy wrapping without restricting movement, supporting healthy development and soothing your child.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis satin trim blanket is machine washable and designed to retain its vibrant colors without fading, ensuring it remains a cherished keepsake for years to come. Personalize it with one or two names to create a truly unique infant swaddle wrap that celebrates your baby's individuality. Pair it with a matching newborn-sized hat for a complete set that enhances the airplane baby blanket theme loved by parents who want both style and function.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features include:\u003c\/p\u003e\u003cp\u003e- Made from thick, luxurious, and stretchy fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides softness and durability for long-lasting use\u003c\/p\u003e\u003cp\u003e- Satin trim edging → adds gentle texture and refined look against sensitive skin\u003c\/p\u003e\u003cp\u003e- Size 39\" tall by 43\" wide → ample coverage for swaddling or cuddling\u003c\/p\u003e\u003cp\u003e- Personalized with one or two names → creates a meaningful keepsake baby blanket\u003c\/p\u003e\u003cp\u003e- Machine washable → easy care without fading or shrinking\u003c\/p\u003e\u003cp\u003e- Matching newborn hat available → complete the set for thoughtful gifting\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eParents love the Jeff the Pilot Keepsake Blankie because it combines practical features with sentimental value. Tested for durability and softness, this baby cuddle blanket stands up to daily wear while remaining gentle enough for newborns. It’s the perfect choice as a baby shower gift or to keep as a treasured comforter throughout infancy.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether you’re looking for an infant swaddle wrap that’s both functional and beautiful or an airplane baby blanket that sparks imagination, this personalized baby blanket delivers on all fronts. Its stretchy fabric supports safe swaddling techniques while providing warmth and security that soothe fussy babies. The satin trim adds texture infants love to touch, enhancing tactile development.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eDiscover why families trust AGreatBaby products for quality and care in every stitch. This machine washable blanket maintains its softness wash after wash, so you can rely on it through countless naps and nighttime cuddles. Celebrate those precious newborn moments with a keepsake baby blanket designed to grow with your child.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580843569402,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580843602170,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580843667706,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348270842,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/jeff-the-pilot-keepsake-blankie-1.jpg?v=1623553079"},{"product_id":"julies-chicken-coop-keepsake-blankie","title":"Personalized Baby Blanket | Custom Name Satin Trim Edges - Luxurious Soft Swaddle","description":"\u003cp\u003eJulie’s Chicken Coop Keepsake Blankie is a personalized baby blanket crafted to provide warmth, comfort, and a charming farm life touch for your little one. This custom name blanket measures a generous 39” by 29”, making it perfect as a soft baby swaddle or nursery receiving blanket that soothes newborns and toddlers alike. Made from a thick, luxurious fabric blend of 86% polyester, 12% rayon, and 2% spandex, this machine washable blankie offers lasting softness and durability that parents trust.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of this farm life blanket include:\u003c\/p\u003e\u003cp\u003e- Thick and plush fabric blend for cozy warmth and softness\u003c\/p\u003e\u003cp\u003e- Satin trim edges that provide gentle comfort against delicate skin\u003c\/p\u003e\u003cp\u003e- Large 39” x 29” size ideal for newborn swaddling wrap or toddler cozy blanket use\u003c\/p\u003e\u003cp\u003e- Personalized with one or two names to create a unique children’s keepsake blanket\u003c\/p\u003e\u003cp\u003e- Machine washable design that resists fading, shrinking, and wear\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby comforter gift combines function with style, delivering a luxurious baby throw that maintains its vibrant colors and smooth texture after every wash. The soft baby swaddle quality helps calm infants during naps, nighttime rest, or stroller rides. Its satin-trimmed edges enhance durability while ensuring a gentle touch on sensitive skin.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eDesigned as both a practical nursery receiving blanket and a heartfelt keepsake, Julie’s Chicken Coop Keepsake Blankie stands out as an ideal baby shower gift. Trusted by parents for its superior quality and personalized charm, this farm life blanket creates lasting memories for families.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eAGreatBaby prioritizes customer satisfaction and backs this product with quality assurance. Explore our full range of blankets at https:\/\/agreatbaby.com\/pages\/what-type-of-blanket-do-i-want to find the perfect match for your family’s needs.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose Julie’s Chicken Coop Keepsake Blankie to celebrate new life with warmth, softness, and a personalized touch that makes every cuddle special.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840095994,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840128762,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840194298,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348434682,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/ca26d58327b33d3d19859429132521b531692bc3.jpg?v=1761426862"},{"product_id":"james-forest-keepsake-blankie","title":"Personalized Baby Blanket – Woodland Animal Blanket with Satin Trim, Soft Plush Luxury","description":"\u003cp\u003eThe Keepsake Baby Blanket – Personalized Woodland Animal Blanket with Satin Trim is a personalized baby blanket designed to provide warmth, comfort, and a touch of magic to your baby's nursery. Measuring 39” x 29”, this soft plush blanket features a delightful woodland animal blanket design that sparks imagination while serving as a cozy baby swaddle blanket from newborn days through toddlerhood. Crafted from a durable fabric blend of 86% Polyester, 12% Rayon, and 2% Spandex, it offers long-lasting softness and gentle stretch that adapts as your child grows.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis custom name blanket can be personalized with one or two names embroidered directly on the fabric, making it a meaningful keepsake baby blanket and a perfect baby shower gift for new parents. The satin trim blanket edge adds an elegant finish and extra softness, enhancing the luxury baby blanket feel. Plus, this nursery decor blanket is machine washable, ensuring vibrant colors remain bright without fading or shrinking even after many washes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cp\u003e- Personalized baby blanket: Custom embroidery creates a unique keepsake\u003c\/p\u003e\u003cp\u003e- Woodland animal blanket design: Inspires creativity and a magical nursery atmosphere\u003c\/p\u003e\u003cp\u003e- Soft plush blanket material: Provides warmth and cozy comfort for newborns and toddlers\u003c\/p\u003e\u003cp\u003e- Machine washable blanket: Easy care with no fading or shrinking after repeated washes\u003c\/p\u003e\u003cp\u003e- Satin trim blanket edge: Adds softness and a premium, elegant finish\u003c\/p\u003e\u003cp\u003e- Size 39\" x 29\": Ideal for swaddling, cuddling, and nursery decoration\u003c\/p\u003e\u003cp\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex): Ensures long-lasting softness and stretch\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eParents appreciate how this baby receiving blanket blends practical use with sentimental value. Tested for quality by AGreatBaby, it meets stringent safety standards to ensure your baby's comfort and well-being. Whether used as a newborn swaddle wrap or cherished nursery accent, this keepsake baby blanket transforms every cuddle into a special moment.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eComplete the set with a matching hat to capture adorable newborn photos filled with warmth and woodland charm. This luxury baby blanket is an ideal baby shower gift or lasting family heirloom that brings the nostalgic charm of fairy tale forests right into your home.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840784122,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840816890,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840882426,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348893434,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/52a2af36979e93088aac23b4ad8c9deaafa5e4ed.jpg?v=1761428605"},{"product_id":"personalized-keepsake-baby-blanket-vintage-bears-in-britches-satin-bound-teddy-bear-blankie","title":"Teddy Bear Blankie - Personalized Baby Keepsake Blanket with Satin Trim, Soft Plush Comforter","description":"\u003cp\u003eThe Personalized Keepsake Baby Blanket - Vintage Bears in Britches is a charming teddy bear blankie designed to provide warmth and comfort while creating lasting memories. This soft baby blanket features classic teddy bears dressed in timeless outfits on a neutral background, personalized with your baby's name in elegant script within the first 160 characters for a truly unique touch. Made from thick, buttery soft fabric, this luxury baby blanket measures 43\" x 39\" and offers cozy comfort for infants and toddlers alike.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby keepsake blanket combines style and function to become a treasured heirloom. Its satin trim blanket finish adds a polished look that fits beautifully in any nursery setting. Crafted from 86% polyester, 12% rayon, and 2% spandex, the plush baby blanket is machine washable and designed to maintain its softness and vibrant colors even after many washes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features include:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized with one or two names for a special keepsake\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin-bound edges for a smooth, elegant finish\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" suitable for swaddling or stroller use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, plush fabric blend delivering lasting warmth and softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket that resists fading and shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Versatile infant comforter ideal for cuddling, naptime, or quiet moments\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Perfect baby boy blanket or girl’s gift blanket for showers or birthdays\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Coordinates seamlessly with other pieces from the Teddy Bear Collection\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis receiving blanket has been tested for durability and softness to ensure it remains gentle on sensitive skin while providing reliable comfort. Parents love this baby swaddle blanket as it offers both warmth and style that grows with their child. The personalized design makes it an unforgettable gift that celebrates new life with thoughtful detail.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eUse this plush baby blanket daily to soothe your infant during naps or stroller rides. Its satin trim blanket finish prevents fraying while adding a touch of luxury. Whether used as a receiving blanket or an infant comforter, this teddy bear blankie is built to last through all stages of early childhood. Trusted by families and recommended by gift experts, it’s the perfect addition to any nursery or baby gear collection.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Boy Teddies In Britches \/ Blanket Only With Giftbox","offer_id":48580842127610,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Boy Teddies In Britches \/ Blanket and Boys Hat With Giftbox","offer_id":48580842160378,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Boy Teddies In Britches \/ Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842225914,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Boy Teddies In Britches \/ Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348926202,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true},{"title":"Girl Teddies In Dresses \/ Blanket Only With Giftbox","offer_id":48623566029050,"sku":null,"price":59.95,"currency_code":"USD","in_stock":false},{"title":"Girl Teddies In Dresses \/ Blanket and Boys Hat With Giftbox","offer_id":48623566061818,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Girl Teddies In Dresses \/ Blanket With Girl's Tied Headband and Giftbox","offer_id":48623566094586,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Girl Teddies In Dresses \/ Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48623566127354,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/teddy_bears_in_clothig_boy_keepsake.jpg?v=1775601720"},{"product_id":"pretty-peony-keepsake-blankie","title":"Personalized Baby Blanket – Watercolor Peony Floral Keepsake With Satin Trim","description":"\u003cp\u003eThe Pretty Peony Keepsake Blankie is a personalized baby blanket designed to celebrate your little girl's special moments with a soft watercolor peony blanket pattern and custom name blanket personalization. This luxury baby blanket measures 39\" tall by 43\" wide and features a satin trim blanket edge, creating a beautiful pink baby blanket perfect for any girls nursery blanket. Crafted from a thick blend of 86% polyester, 12% rayon, and 2% spandex, this soft baby throw offers warmth and comfort while remaining lightweight enough for daily use. The personalized baby blanket is machine washable and will not fade, ensuring it stays vibrant through countless washes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby keepsake blanket combines delicate design with practical features that make it an ideal infant receiving blanket or baby swaddle wrap. The floral baby blanket pattern adds charm to any nursery, while its durable construction guarantees long-lasting use.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003e- Personalized with one or two names for a unique touch\u003c\/p\u003e\u003cp\u003e- Made from a premium blend of polyester, rayon, and spandex for softness and durability\u003c\/p\u003e\u003cp\u003e- Satin trim enhances the aesthetic appeal and adds gentle texture\u003c\/p\u003e\u003cp\u003e- Measures 39\" tall by 43\" wide, suitable for swaddling, cuddling, or stroller use\u003c\/p\u003e\u003cp\u003e- Machine washable fabric maintains color and softness after washing\u003c\/p\u003e\u003cp\u003e- Lightweight yet warm for year-round comfort\u003c\/p\u003e\u003cp\u003e- Perfect as a gift or keepsake for baby showers and newborn celebrations\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eParents love this personalized baby blanket for its combination of style and function. Tested for quality and durability, it withstands everyday use without pilling or fading. The satin trim blanket detail adds an elegant finish that complements the watercolor peony design beautifully. Whether used as an infant receiving blanket or a soft baby throw during naps and tea party picnics, this pink baby blanket will be treasured for years.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose the Pretty Peony Keepsake Blankie to add a meaningful, custom touch to your baby's nursery essentials. This floral baby blanket is more than just a swaddle wrap—it's a lasting memory wrapped in softness.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841996538,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842029306,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842094842,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348467450,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/IMG_9749tu.jpg?v=1650401490"},{"product_id":"winnie-the-pooh-keepsake-blankie-boy-and-girl-option","title":"Winnie the Pooh Blanket - Personalized Baby Keepsake Blanket With Satin Trim","description":"\u003cp\u003eThe Winnie the Pooh blanket is a charming and soft baby keepsake blanket designed to bring comfort and nostalgia to your little one’s nursery. Made with thick and luxurious material, this personalized baby blanket features a vintage Winnie the Pooh print that captures the magic of the 100 acre wood, making it perfect as a nursery baby blanket or newborn photo prop. Measuring 39\" tall by 43\" wide, this satin trim blanket is both functional and decorative, offering a cozy, machine washable blanket option that will not fade after washing. Whether you choose the boy or girl option, each blanket can be personalized with one or two names, making it an ideal Disney baby blanket or baby shower gift that families will treasure for years.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis soft baby swaddle is crafted from 86% polyester, 12% rayon, and 2% spandex for gentle stretch and durability. The satin-trimmed edges provide a smooth finish that enhances comfort and elegance. The Winnie the Pooh keepsake blankie is designed to withstand everyday use while maintaining its vibrant colors and softness.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features include:\u003c\/p\u003e\u003cp\u003e- Personalized baby blanket with one or two names for a unique touch\u003c\/p\u003e\u003cp\u003e- Vintage Winnie the Pooh design inspired by the beloved 100 acre wood characters\u003c\/p\u003e\u003cp\u003e- Measures 39\" tall by 43\" wide for ideal swaddling and cuddling size\u003c\/p\u003e\u003cp\u003e- Made from a soft blend of polyester, rayon, and spandex for durability and comfort\u003c\/p\u003e\u003cp\u003e- Satin trim blanket edges add a smooth, gentle finish\u003c\/p\u003e\u003cp\u003e- Machine washable blanket that resists fading and shrinking\u003c\/p\u003e\u003cp\u003e- Available in boy and girl options with matching knotted headbands\u003c\/p\u003e\u003cp\u003e- Perfect as a newborn photo prop or nursery baby blanket\u003c\/p\u003e\u003cp\u003e- An excellent Disney baby blanket choice and thoughtful baby shower gift\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis Winnie the Pooh blanket has been tested for quality to ensure long-lasting softness and color retention even after multiple washes. Parents appreciate how easy it is to care for while providing their babies with warmth and comfort during sleep or playtime. The matching knotted headbands in blue font for boys or pink font for girls complete the set, adding an adorable accessory to your baby's outfit.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eBring home this timeless keepsake blankie to create lasting memories with your child. Its nostalgic design combined with practical features makes it a must-have for every nursery. Whether as a gift or a personal purchase, this satin trim blanket from AGreatBaby offers both style and substance in one cherished package.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580842520826,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842553594,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842619130,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348107002,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/winniethepoohboyset.jpg?v=1658779003"},{"product_id":"patriotic-puppy-keepsake-blankie","title":"Patriotic Puppy Blankie - Personalized Baby Keepsake Blanket with Satin Trim","description":"\u003cp\u003eThe Patriotic Puppy Blankie is a soft plush baby blanket designed to celebrate your love for America while keeping your little one cozy. This luxurious baby blankie features a charming patriotic puppy design, making it the perfect Fourth of July blanket or a thoughtful military family gift. Crafted from a premium blend of 86% polyester, 12% rayon, and 2% spandex, this baby keepsake blanket measures 39\" tall by 43\" wide and offers a satin trim that adds both elegance and comfort. Personalized with one or two names, it becomes a unique gender neutral baby gift that families will treasure for years.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis infant receiving blanket is machine washable and will not fade, ensuring it stays vibrant wash after wash. The thick material provides warmth and softness for newborn swaddle blankets while remaining lightweight enough for everyday use.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003e- Made from thick, luxurious material (86% polyester, 12% rayon, 2% spandex) → ensures lasting softness and durability\u003c\/p\u003e\u003cp\u003e- Satin trim blanket → adds smooth texture and elegant finish\u003c\/p\u003e\u003cp\u003e- Size: 39\" tall by 43\" wide → ideal for swaddling or cuddling\u003c\/p\u003e\u003cp\u003e- Personalized with one or two names → creates a unique keepsake\u003c\/p\u003e\u003cp\u003e- Machine washable blanket → easy care without fading\u003c\/p\u003e\u003cp\u003e- Gender neutral baby gift → perfect for any nursery or celebration\u003c\/p\u003e\u003cp\u003e- Features an American flag blanket design with patriotic puppy motif → celebrates national pride\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eDesigned by AGreatBaby, this patriotic puppy blankie has been praised by parents for its exceptional quality and sentimental value. It’s a perfect newborn swaddle blanket that doubles as a memorable keepsake to honor your family’s heritage. Whether you’re preparing for a baby due near the Fourth of July or looking for a meaningful military family gift, this personalized baby blanket offers both style and comfort.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eCelebrate your baby's first holidays with this soft plush baby blanket that combines function with heartfelt patriotism. Its durable construction means it will remain a cherished item in your child’s nursery for years to come. The smooth satin trim prevents irritation on delicate skin while enhancing the overall look of the blanket.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose the Patriotic Puppy Blankie as your go-to infant receiving blanket to provide warmth, security, and a touch of American pride. Its machine washable fabric makes it practical for busy parents who want both convenience and quality in their baby gear.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841865466,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580841898234,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841963770,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348401914,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/patrioticpuppyredwhiteandblue4thofjulymemorialdaypuppylabflagamericanflagpersonalizedbabyshowergiftgenderneutral_7_sq.jpg?v=1677776663"},{"product_id":"amelias-pink-floral-keepsake-blankie","title":"Amelia's Pink Floral Keepsake Blankie","description":"\u003cdiv\u003eIntroduce your little princess to the world with a beautiful personalized floral baby blanket!\u003c\/div\u003e\n\u003cdiv\u003eOur Amelia's Pink Floral swaddle is the perfect eye-catching accessory for photos and play dates, stroller rides and outings . . . and whispered coffee orders at the drive-thru while baby naps in the car seat again.\u003c\/div\u003e\n\u003cul\u003e\n\u003cli\u003e\u003cspan\u003eKeepsake blankie made with thick and luxurious material (86% Polyester, 12% Rayon, 2% Spandex)\u003c\/span\u003e\u003c\/li\u003e\n\u003cli\u003eSatin-trimmed\u003c\/li\u003e\n\u003cli\u003e39\" tall by 43\" wide \u003c\/li\u003e\n\u003cli\u003ePersonalized with one name or two\u003c\/li\u003e\n\u003cli\u003eMachine washable and will not fade \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cp\u003e\u003cimg src=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Keepsake_Blankie_1_496f9593-dcb8-4859-a30e-79b1a4140bb6_600x600.png?v=1622635033\" alt=\"\"\u003e\u003cimg alt=\"\" src=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Keepsake_Blankie_2_4d24ecd5-7051-40af-ba02-12e34e9fab44_600x600.png?v=1622635078\" data-mce-fragment=\"1\" data-mce-src=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Keepsake_Blankie_2_4d24ecd5-7051-40af-ba02-12e34e9fab44_600x600.png?v=1622635078\"\u003e\u003c\/p\u003e\n\u003cdiv style=\"text-align: left;\"\u003e\u003cimg src=\"https:\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Copy_of_Copy_of_Copy_of_Size_44_X_38_1_600x600.png?v=1621991396\" alt=\"\"\u003e\u003c\/div\u003e\n\u003cdiv style=\"text-align: left;\"\u003eLearn about all of our blankets \u003ca href=\"https:\/\/agreatbaby.com\/pages\/what-type-of-blanket-do-i-want\" target=\"_blank\"\u003ehere\u003c\/a\u003e\n\u003c\/div\u003e\n\u003cul\u003e\u003c\/ul\u003e\n\u003cul\u003e\u003c\/ul\u003e","brand":"AGreatBaby","offers":[{"title":"Amelia's Pink Floral \/ blanket only","offer_id":44001929167098,"sku":null,"price":24.0,"currency_code":"USD","in_stock":true},{"title":"Amelia's Pink Floral \/ blanket and headband","offer_id":44001929199866,"sku":null,"price":62.95,"currency_code":"USD","in_stock":true},{"title":"Amelia's Pink Floral \/ blanket and hat with bow","offer_id":44001929232634,"sku":null,"price":64.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/products\/ameliapinkandpurplefloralkeepsakeblankiebabygift.jpg?v=1676665775"},{"product_id":"marys-blue-floral-keepsake-blankie","title":"Personalized Baby Blanket – Blue Floral Stretchy Swaddle With Satin Trim and Hydrangeas","description":"\u003cp\u003eThe Hydrangeas Personalized Keepsake Blanket is a luxurious personalized baby blanket designed to provide warmth, comfort, and lasting memories for your little girl. Crafted with a delicate light blue floral baby blanket print on a crisp white background, this custom name blanket combines elegance with functionality to create the perfect keepsake swaddle. Measuring 39” x 29”, this satin trim blanket features thick, soft fabric made of 86% polyester, 12% rayon, and 2% spandex, offering a cozy weight that is gentle on newborn skin while durable enough for toddler naps and stroller rides.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis blue baby blanket is machine washable and will not fade over time, making it an ideal baby photo accessory and everyday essential. The smooth satin binding adds durability and a refined finish, ensuring the blanket maintains its softness and shape through years of use. Personalized with one or two names, this girls floral blanket becomes a treasured heirloom that celebrates milestones and creates lasting memories.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features include:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Luxuriously thick fabric blend (86% Polyester, 12% Rayon, 2% Spandex) for lasting softness and comfort\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket design that is gentle against baby's skin and enhances durability\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 39” x 29” perfect for swaddling, cuddling, or stroller use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Custom name blanket personalization with one or two names for a unique touch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket that resists fading and maintains quality after repeated washes\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Elegant light blue floral baby blanket print that complements any nursery décor\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis luxury baby blanket has been designed to grow with your child—from newborn snuggles to toddler naps—providing warmth and comfort at every stage. The keepsake swaddle’s premium materials ensure it remains soft and cozy while standing up to daily use. Parents appreciate the meaningful personalization option that makes this baby receiving blanket an ideal gift for showers, birthdays, or special occasions.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWith its timeless design and practical features, the Hydrangeas Personalized Keepsake Blanket is more than just a soft newborn blankie; it’s a cherished accessory that enhances every moment from photo shoots to quiet cuddles. Backed by AGreatBaby’s commitment to quality and customer satisfaction, this floral baby blanket offers both style and substance for your little girl’s nursery essentials.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840915194,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840947962,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841013498,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348369146,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/N3A7120.jpg?v=1771448201"},{"product_id":"new-baby-bundle-copy","title":"Keepsake Blankie – Luxury Baby Blanket With Satin Trim | Personalized Gift Box","description":"\u003cp\u003eThe Keepsake Blankie is the ultimate baby receiving blanket designed to provide newborns with unmatched comfort and warmth from their very first snuggles. Crafted from buttery soft fabric, this soft baby blanket measures 43 inches wide by 39 inches tall, making it the perfect size for swaddling or as a receiving blanket alternative. Each Keepsake Blankie features a luxurious satin trim blanket edge that adds elegance and durability, ensuring it stands out as a true heirloom baby blanket. Packaged in a beautifully designed baby blanket gift box, it arrives ready to be gifted as a personalized baby gift that every parent will cherish.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis snuggle baby blanket offers multiple benefits for infants and parents alike:\u003c\/p\u003e\u003cp\u003e- Buttery soft fabric provides gentle comfort that soothes and calms newborns\u003c\/p\u003e\u003cp\u003e- Satin trim blanket edges enhance durability while adding a refined look\u003c\/p\u003e\u003cp\u003e- Generous 43\" x 39\" size makes it ideal for newborn swaddle wrap or infant comfort wrap\u003c\/p\u003e\u003cp\u003e- Comes in a luxury baby blanket gift box perfect for special occasions\u003c\/p\u003e\u003cp\u003e- Personalized baby gift option makes each blanket unique and memorable\u003c\/p\u003e\u003cp\u003e- Designed to be an heirloom baby blanket that can be treasured for years\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eOriginally introduced over a decade ago by AGreatBaby, the Keepsake Blankie quickly became the brand’s signature product due to its thickness, quality, and timeless appeal. After the original Ponte Knit fabric was discontinued, AGreatBaby developed an upgraded version made from a luxe, cushy stretchy fabric that feels like a dream against delicate skin. This modern version maintains the classic satin trim and now comes beautifully boxed for gifting or safekeeping.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eTested by thousands of happy parents, this receiving blanket alternative has proven its lasting quality and comfort through years of use. Its soft texture ensures babies stay cozy without overheating, while the stretchy fabric allows gentle movement without losing shape. Whether used as a newborn swaddle wrap or a snuggle companion throughout infancy, the Keepsake Blankie delivers consistent warmth and tenderness.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose the Keepsake Blankie for your next infant comfort wrap or personalized baby gift to give lasting memories wrapped in luxury. Its combination of premium materials, thoughtful design, and elegant presentation make it one of the best soft baby blankets available today. Perfect for showers, birthdays, or welcoming home your little one, this heirloom baby blanket brings joy from first cuddle to forever keepsake.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Bailey Spring Floral","offer_id":47794344165626,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Baseballs and Bows","offer_id":47794344198394,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Bass Fisher","offer_id":47794344231162,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Beach Print","offer_id":47794344263930,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"English Floral","offer_id":47794344329466,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blue Football","offer_id":47794344362234,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Pink Football","offer_id":47794344395002,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Brittney Springer","offer_id":47794372673786,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Chicken","offer_id":47794372706554,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Colleen Blue","offer_id":47794372739322,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Colleen Mauve","offer_id":47794372772090,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Courtney Floral","offer_id":47794372804858,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Crabbie Cutie","offer_id":47794372837626,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Deer Hunter","offer_id":47794372870394,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Emersynn","offer_id":47794372903162,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Emily Floral","offer_id":47794372935930,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Fox In The Forest","offer_id":47794372968698,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Garden of Eden","offer_id":47794373001466,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Girl's Basketball","offer_id":47854916993274,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Golf Day","offer_id":47794373034234,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Gray Mudcloth","offer_id":47794373067002,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Harper Jane","offer_id":47794373099770,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Harvest Yellow","offer_id":47794373132538,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Heirloom bows","offer_id":47794373165306,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Hospital Stripes","offer_id":47794373198074,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Hydrangeas","offer_id":47794373230842,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"James Forest","offer_id":47794373263610,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Jeffrey The Pilot","offer_id":47794373296378,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Little Digger","offer_id":47794373329146,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Little Lobster","offer_id":47794373361914,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Little Slugger","offer_id":47794373394682,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Mallard Duck Blue","offer_id":47794373427450,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Mallard Duck Green","offer_id":47794373460218,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Moses Deer","offer_id":47794373492986,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"National Parks","offer_id":47794373525754,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Navy Fall","offer_id":47794373558522,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Neutral Ballerinas","offer_id":47794373591290,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Noah's Ark","offer_id":47794373624058,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Patriotic Puppy","offer_id":47794373656826,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Patti Floral","offer_id":47794373689594,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Peach Blossom","offer_id":47794373722362,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Peter Rabbit","offer_id":47794373755130,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Pink Bows","offer_id":47794373787898,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blue Bows Monogram","offer_id":47794344296698,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Black Bows","offer_id":48289829781754,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Pink Soccer","offer_id":47794373820666,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blue Soccer","offer_id":47794373853434,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Plum Perfect","offer_id":47794373886202,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Pointer Dogs","offer_id":47794373918970,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Pretty Peony OG","offer_id":47794506367226,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Quilt Coquette","offer_id":48439304323322,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Sergeant Safari","offer_id":47794373951738,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Sidney Alexandra","offer_id":47794373984506,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Silly Goose Boy","offer_id":47794374017274,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Silly Goose Girl","offer_id":47794374050042,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Strawberry Summer","offer_id":48454767182074,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"The Great Outdoors","offer_id":47794374082810,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"To Grandmother's House We Go","offer_id":48062746984698,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Tractors","offer_id":47794374115578,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Vintage Teddy Bears","offer_id":47794374148346,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Violet Fields","offer_id":47794374181114,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Western Toille","offer_id":47794374213882,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Whales","offer_id":47794374246650,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"wildflowers","offer_id":47794374279418,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Winnie The Pooh Boy","offer_id":47794374312186,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Winnie the Pooh Girl","offer_id":47794374344954,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Woodland Animals","offer_id":47794506399994,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/KEEPSAKE_BLANKIES_6dbd20e8-1689-49e0-a8ad-5abe405deec2.jpg?v=1774376162"},{"product_id":"personalized-silly-goose-boy-receiving-blanket-luxury-baby-keepsake","title":"Personalized Baby Blanket – Luxury Silly Goose Boy Receiving Blanket With Satin Trim","description":"\u003cp\u003eThe Personalized Silly Goose Boy Receiving Blanket is a premium personalized baby blanket designed to provide warmth, comfort, and a cherished keepsake for newborns and toddlers. Crafted by AGreatBaby, this luxury baby blanket features a custom name blanket personalization on a soft plush blanket that measures 39\" x 29\", making it the perfect size for swaddling, cuddling, and nursery decoration. Its buttery soft fabric blend (86% Polyester, 12% Rayon, 2% Spandex) offers durable stretch and lasting softness, ensuring your baby stays cozy during naps, car rides, or tummy time.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis baby receiving blanket showcases a gentle woodland animal blanket design with minimal geese prints and soft blue ribbons, creating a magical nursery atmosphere ideal for spring babies and special moments like first Easter celebrations. Finished with a satin trim blanket edge, it adds an elegant touch while maintaining gentle softness against delicate skin. The machine washable blanket is easy to care for, resisting fading or shrinking even after repeated washes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket: Custom name printing creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush blanket material: Provides warmth and cozy comfort for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Woodland animal blanket design: Inspires creativity and adds charm to any baby nursery\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edge: Offers a premium finish with extra softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\": Ideal for newborn swaddle blankets, cuddling, and stroller use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex): Ensures long-lasting softness with gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket: Easy maintenance without fading or shrinking\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis personalized receiving blanket from AGreatBaby is more than just a baby nursery blanket—it’s a treasured baby keepsake gift perfect for spring baby shower gifts or welcoming new arrivals. Trusted by parents for its quality and thoughtful design, it holds special memories from the very first cuddle through toddlerhood. Whether used as a newborn swaddle blanket or a cozy cover during car rides and naps, this luxury baby blanket combines function with heartfelt personalization to make every moment memorable.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580839833850,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580839866618,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580839932154,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348795130,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/PP0A1543.jpg?v=1768423798"},{"product_id":"floral-toile-baby-girl-keepsake","title":"Baby Girl Blanket - Floral Toile Design Plush Keepsake Single-Sided Nursery Blanket","description":"\u003cp\u003eThe Floral Toile Baby Girl Keepsake Blankie is a premium baby girl blanket designed to provide warmth, comfort, and lasting memories for your little one. Crafted with soft minky fabric, this cozy baby blanket offers gentle touch and superior softness, making it the perfect nursery blanket for infants and toddlers alike. Measuring an ideal size for cuddling and napping, this double sided blanket features an elegant floral toile design that adds a classic charm to any nursery. As a personalized baby blanket option, it serves as a thoughtful baby shower gift or baby gift idea that new parents will cherish.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis plush toddler blanket is made with durable stitching to withstand daily use while maintaining its softness and vibrant pattern. The soft minky fabric ensures breathability and warmth without overheating, providing a comfortable infant comforter that soothes your child during sleep or playtime. Tested for safety and hypoallergenic properties, this baby keepsake blanket meets rigorous quality standards to protect delicate skin.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of the Floral Toile Baby Girl Keepsake Blankie include:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Double sided blanket with floral toile design for style and versatility\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft minky fabric that delivers plush comfort and gentle warmth\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Ideal size for toddlers and infants to snuggle or use as a nursery blanket\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable construction designed to last through countless washes\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized option available to add a name or special message\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Perfect baby shower gift or baby gift idea for new parents\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Hypoallergenic and safety tested for infant use\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis toddler blanket combines style and function, offering both aesthetic appeal and practical comfort. Its lightweight yet cozy material makes it easy to carry on outings or keep at home as a favorite infant comforter. The personalized baby blanket feature allows you to create a unique keepsake that celebrates your baby's arrival or milestones.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eAGreatBaby stands behind the quality of this floral toile baby girl keepsake blankie with a satisfaction guarantee, ensuring you receive a product that meets your expectations in both appearance and performance. Whether used as a nursery staple or gifted at a baby shower, this cozy baby blanket brings warmth, softness, and timeless charm to your baby's everyday routine.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840521978,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840554746,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840620282,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584347943162,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Blue_Floral_Toile_Keepsake.jpg?v=1770664998"},{"product_id":"personalized-violet-fields-baby-girl-receiving-blanket-luxury-double-layer-keepsake-with-satin-binding","title":"Personalized Baby Blanket – Violet Fields Floral Receiving Blanket with Satin Trim","description":"\u003cp\u003eThe Personalized Violet Fields Baby Girl Receiving Blanket is a luxury double layer blanket designed to offer warmth and comfort while serving as a cherished keepsake. This personalized baby blanket features your baby's name printed on a soft plush fabric with a delicate floral baby blanket design, providing a meaningful touch that makes it perfect for newborn swaddle blankets and nursery receiving blankets. Measuring 39\" x 29\", it’s ideal for cuddling, stroller use, tummy time, and quiet moments at home.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMade from a durable fabric blend of 86% polyester, 12% rayon, and 2% spandex, this soft plush blanket delivers long-lasting softness with gentle stretch. The satin trim blanket edge adds a premium finish and extra softness against your baby's skin. This machine washable blanket maintains its vibrant colors and texture even after repeated washes, ensuring it remains a treasured keepsake newborn gift for years to come.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush blanket material provides cozy warmth for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Floral baby blanket design adds timeless charm to any nursery\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edge offers a smooth, premium finish for extra comfort\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" is perfect as a newborn swaddle blanket or stroller cover\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable double layer blanket fabric blend ensures softness with gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket allows easy cleaning without fading or shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Luxury baby gift option ideal for baby showers, birthdays, or special milestones\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eCrafted by AGreatBaby with attention to detail, this nursery receiving blanket combines style and function. The thick double layer fabric feels substantial yet lightweight, making it perfect for everyday use. The personalized custom name blanket aspect adds sentimental value that makes this baby girl blanket stand out among typical receiving blankets. Tested for quality and durability, it promises softness and resilience through all your baby's early years.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used during tummy time or as a cozy wrap on chilly evenings, this keepsake newborn gift offers both comfort and beauty. The gentle violet floral pattern complements any nursery décor while the satin binding ensures lasting elegance. Choose this personalized baby blanket to create lasting memories wrapped in luxury and care.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580839702778,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580839735546,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580839801082,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348565754,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/violetfieldskeepsake.jpg?v=1770671405"},{"product_id":"personalized-bailey-spring-floral-baby-girl-receiving-blanket-vintage-ivory-keepsake-with-satin-binding","title":"Personalized Baby Blanket - Floral Baby Receiving Blanket with Satin Trim, Custom Name Keepsake","description":"\u003cp\u003eThis personalized baby blanket, the Bailey Spring Floral Baby Girl Receiving Blanket, offers a soft, vintage ivory keepsake designed to provide warmth, comfort, and lasting memories. Crafted from buttery soft fabric with a satin trim blanket edge, this custom name blanket measures 39\" tall by 43\" wide and is perfect as a newborn swaddle blanket or a cherished nursery blanket decor piece. The floral baby blanket features delicate butterflies and dainty florals that enhance any nursery style, from cottagecore baby blanket themes to classic vintage looks.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush baby blanket material ensures cozy warmth and comfort for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Floral baby blanket design adds charm and beauty to nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edge provides a premium finish with extra softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide ideal for swaddling, cuddling, stroller rides, and newborn photos\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) offers gentle stretch and long-lasting softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket maintains color and texture without fading or shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Vintage baby blanket style blends perfectly with cottagecore baby blanket aesthetics\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis baby receiving blanket combines style and function by using a thick double-layer fabric that feels substantial yet gentle on delicate skin. The buttery soft fabric ensures your little one stays comfortable during naps or stroller rides. The satin trim blanket edge adds a touch of elegance while reinforcing durability for everyday use. Tested for quality by AGreatBaby, this machine washable blanket resists wear and maintains softness wash after wash.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eIdeal as a baby shower gift, this custom name blanket makes an unforgettable present that parents will treasure for years. Its versatile size and charming floral pattern make it suitable as both a newborn swaddle blanket and nursery decor accent. Whether used for quiet moments at home or outdoor strolls, this personalized baby blanket delivers warmth, comfort, and timeless style.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841439482,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580841472250,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841537786,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348238074,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/baileykeepsakeblankiemockup.jpg?v=1770671805"},{"product_id":"personalized-wildflower-baby-girl-receiving-blanket-pastel-floral-keepsake-on-white-with-satin-binding","title":"Personalized Baby Blanket – Pastel Floral Receiving Blanket With Satin Trim Edge","description":"\u003cp\u003eThis personalized baby blanket is a delicate and timeless keepsake designed to provide warmth and comfort for newborns and toddlers. The Wildflower Baby Girl Keepsake Blankie features a soft white background adorned with pastel floral patterns, personalized with your baby's name to create a truly unique newborn keepsake gift. Crafted from a thick, buttery soft double-layer fabric with satin trim edge, this floral receiving blanket measures 39\" x 29\", making it ideal as a baby swaddle blanket or cozy toddler blanket. The durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) ensures long-lasting softness with gentle stretch, while the machine washable blanket design offers easy care without fading or shrinking.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing → creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft and thick double-layer material → provides cozy warmth and comfort for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Pastel floral blanket design → adds charm and beauty to any baby nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edge → offers a premium finish with extra softness against delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" → perfect for swaddling, cuddling, stroller rides, and tummy time\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) → ensures lasting softness and gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean without losing vibrancy or shape\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis cottage style baby blanket is crafted with quality meant to last. The opulent fabric offers a cozy, comforting weight without feeling heavy, making it perfect for everyday use. The soft pastel wildflowers bring a fresh, natural feel that complements nursery themes from classic to modern or cottage style baby rooms. Trusted by parents for its durability and softness, this receiving blanket cotton blend is designed to be used often and treasured for years.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used as a swaddle during newborn photos or as a cozy toddler blanket on stroller rides, this personalized baby blanket makes an exceptional newborn keepsake gift. Its combination of thoughtful design, premium materials, and easy maintenance makes it an essential addition to any baby's collection.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841177338,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580841210106,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841275642,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348860666,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/wildflower_keepsake.jpg?v=1774453645"},{"product_id":"personalized-blue-english-floral-baby-receiving-blanket-luxury-keepsake-with-satin-binding","title":"Personalized Baby Blanket - Blue Floral Receiving Blanket with Satin Trim","description":"\u003cp\u003eThis personalized baby blanket offers a luxurious and cozy wrap for newborns, combining style and comfort to create a cherished keepsake. The Personalized Blue English Floral Baby Receiving Blanket features delicate blue flowers on a crisp white background, personalized with your baby's name to make it truly unique. Crafted from thick, buttery soft double layer fabric, this soft plush blanket ensures warmth and gentle comfort for your little one while adding charm to nursery decor.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush blanket material provides cozy warmth and comfort for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Blue floral blanket design adds timeless beauty and elegance to nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edge delivers a premium finish with extra softness against delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" ideal for swaddling, cuddling, stroller rides, and newborn photography\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable double layer fabric blend (86% Polyester, 12% Rayon, 2% Spandex) offers gentle stretch and long-lasting softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable to maintain color vibrancy and texture without fading or shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Vintage-inspired cottagecore baby blanket style complements classic and modern nursery themes\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Keepsake baby blanket designed to be treasured for years with lasting quality and comfort\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eMade by AGreatBaby, this baby receiving blanket is crafted with exceptional attention to detail and quality. The satin trim blanket edges prevent fraying while enhancing softness for sensitive skin. Its durable fabric blend withstands frequent washing without losing structure or softness, making it perfect as a swaddle baby blanket or cozy baby wrap during naps and outings. This custom name blanket is an ideal newborn gift idea that combines function with sentimental value.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used as a nursery decor blanket or a practical swaddling essential, this personalized baby blanket balances beauty with performance. The double layer fabric keeps babies warm without overheating, while the soft plush texture invites snuggles throughout the day. Its size fits perfectly for cuddling in cribs or strollers, ensuring your child stays comfortable wherever they go.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose this personalized keepsake baby blanket to celebrate new arrivals with a thoughtful gift that lasts beyond the newborn stage. Its vintage floral pattern blends effortlessly into cottagecore nursery designs, creating an inviting space filled with warmth and charm. Backed by positive customer reviews praising its softness and durability, this satin trim blanket is designed to be loved now and treasured forever.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580841308410,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580841341178,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841406714,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348139770,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/blueenglishkeepsake2.jpg?v=1770928213"},{"product_id":"personalized-peach-blossom-baby-receiving-blanket-watercolor-floral-keepsake-with-satin-binding","title":"Personalized Baby Blanket – Peach Blossom Floral Receiving Blanket with Satin Trim","description":"\u003cp\u003eThis personalized baby blanket is a beautiful and practical keepsake designed to provide warmth and comfort while celebrating your little one. The Personalized Peach Blossom Baby Receiving Blanket features a delicate watercolor floral design with peach blossoms scattered across a crisp white background, personalized with your baby’s name to create a unique custom name blanket that will be treasured for years. Crafted from a soft plush baby blanket fabric blend of 86% polyester, 12% rayon, and 2% spandex, it offers gentle stretch and long-lasting softness, making it perfect for newborn swaddle blanket use, stroller rides, naps, and cuddles.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eSized at 39\" x 29\", this cozy baby wrap is ideal for swaddling infants or layering in nursery decor. The satin trim blanket edge adds a premium finish with extra softness that feels gentle on delicate skin. This floral baby blanket combines vintage baby blanket charm with modern cottagecore baby blanket aesthetics, making it an elegant addition to any nursery. It is machine washable and retains its color and texture without fading or shrinking, ensuring durability through countless washes.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby receiving blanket with custom name printing for a meaningful keepsake\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush baby blanket fabric blend (86% Polyester, 12% Rayon, 2% Spandex) for cozy warmth and gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Watercolor floral blanket design featuring peach blossoms for timeless nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edges provide a smooth, luxurious finish that protects delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" perfect for newborn swaddle blanket use, stroller rides, and cuddling\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable fabric maintains softness and vibrant colors without shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Vintage baby blanket style with cottagecore baby blanket appeal enhances nursery aesthetics\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Ideal baby shower gift that combines style and function for new parents\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThoughtfully crafted to balance beauty and comfort, this nursery decor blanket is as practical as it is charming. The thick double-layer fabric provides warmth without bulk, supporting your baby's comfort during naps or outings. Parents appreciate how this custom name blanket grows with the child as a treasured keepsake. Backed by AGreatBaby's reputation for quality, this personalized baby receiving blanket offers both style and lasting durability.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used as a newborn swaddle blanket or a cozy wrap during stroller rides, this floral baby blanket delivers comfort while adding an elegant touch to your baby's space. Its vintage-inspired design fits perfectly with modern nurseries or those styled with cottagecore elements. Give the gift of warmth and personalized charm with this soft plush baby blanket that will be loved now and preserved as a family heirloom.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840259834,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840292602,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840358138,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584347975930,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/peachblossomkeepsakeblanket.jpg?v=1770929148"},{"product_id":"personalized-emersynn-floral-baby-receiving-blanket-boho-keepsake-on-mauve-with-satin-binding","title":"Personalized Baby Blanket - Floral Baby Receiving Blanket with Satin Trim | Boho Nursery Decor","description":"\u003cp\u003eThe Personalized Emersynn Floral Baby Receiving Blanket is a soft plush blanket designed to keep your newborn warm and cozy while adding charm to nursery decor. This personalized baby blanket features a custom name blanket option, making it a unique keepsake that grows with your child. Crafted from a durable fabric blend of 86% polyester, 12% rayon, and 2% spandex, it offers gentle stretch and long-lasting softness. The floral baby blanket design with delicate blossoms on a muted mauve background and satin trim blanket edges bring a subtle boho baby blanket style to any nursery. Measuring 39\" x 29\", this newborn swaddle blanket is perfect for swaddling, cuddling, stroller rides, and newborn photos. Machine washable for easy care, the vintage baby blanket maintains its color and texture without fading or shrinking after multiple washes.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing creates a meaningful keepsake for your little one\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush blanket material provides cozy warmth and comfort for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Floral baby blanket design enhances nursery decor with timeless beauty\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edges offer a smooth, premium finish with extra softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size of 39\" x 29\" ideal for swaddling, cuddling, stroller rides, and newborn photos\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) ensures gentle stretch and lasting softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket keeps its vibrant color and soft texture wash after wash\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Vintage baby blanket style perfectly complements neutral or boho nursery themes\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Boho baby blanket aesthetic adds warmth and softness to any nursery space\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Baby shower gift choice that combines practicality with sentimental value\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Baby cuddle blanket ideal for naps, playtime, and everyday comfort\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis personalized baby receiving blanket from AGreatBaby combines vintage charm with modern functionality. The buttery soft double-layer fabric offers a comforting weight that is gentle on delicate skin. The floral pattern paired with elegant script font for the baby's name creates a primitive yet timeless look cherished by parents. Trusted by thousands of families, this machine washable nursery decor blanket is designed to withstand daily use while remaining soft and beautiful. Whether used as a newborn swaddle blanket or an everyday cuddle companion, this satin trim blanket delivers warmth and style that lasts through childhood.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580842389754,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842422522,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842488058,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348991738,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/AGreatBaby-19.jpg?v=1771016227"},{"product_id":"personalized-rosie-posie-baby-receiving-blanket-vintage-pink-roses-keepsake-with-satin-binding","title":"Personalized Baby Blanket – Vintage Pink Roses Floral Receiving Blanket with Satin Trim","description":"\u003cp\u003eThis personalized baby blanket features a vintage pink roses blanket design that combines classic floral charm with the warmth and softness needed for newborns and toddlers. Crafted as a keepsake baby gift, this custom name blanket measures 39\" x 29\", making it ideal for swaddling, cuddling, stroller rides, and newborn photos. The soft plush baby blanket material, made from a durable fabric blend of 86% Polyester, 12% Rayon, and 2% Spandex, offers gentle stretch and lasting comfort. Designed to maintain its beauty after every wash, this machine washable blanket preserves color and texture without fading or shrinking.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with elegant script name printing creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Floral baby blanket design featuring vintage pink roses adds timeless charm to any nursery decor blanket\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush baby blanket fabric delivers cozy warmth and comfort for babies and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edge provides a smooth, premium finish with extra softness against delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Medium weight baby blanket construction balances warmth with breathability for year-round use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" perfect for swaddle and cuddle blanket needs during naps, outings, and photoshoots\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend ensures an heirloom quality blanket that lasts through everyday use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket offers easy care without sacrificing softness or vibrant color\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis heirloom quality blanket is thoughtfully designed to be both beautiful and functional. The vintage-inspired floral baby blanket style blends perfectly with feminine nursery decor while offering practical benefits. The satin trim blanket edge enhances durability and comfort, ensuring your child enjoys gentle softness every time. Tested for lasting softness and resilience, this keepsake baby gift is backed by AGreatBaby’s commitment to quality.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eIdeal as a baby receiving blanket or a special present for showers and newborn celebrations, this medium weight baby blanket supports cuddling, swaddling, and comforting routines. Its soft plush texture invites snuggles while the personalized touch makes it a treasured family favorite. Whether used daily or saved for milestone moments, this nursery decor blanket combines style, comfort, and meaningful personalization in one premium package.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580839964922,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580839997690,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840063226,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348664058,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/PhotoFeb02_51608PM.jpg?v=1771017102"},{"product_id":"personalized-garden-of-eden-baby-receiving-blanket-muted-floral-keepsake-on-beige-knit","title":"Personalized Baby Blanket – Garden of Eden Floral Baby Receiving Blanket with Satin Trim Keepsake","description":"\u003cp\u003eThis personalized baby blanket offers a soft, cozy wrap that transforms into a cherished keepsake for your little one. The Garden of Eden Baby Receiving Blanket features a muted floral print on warm beige knit fabric, designed to provide comfort and style while celebrating your newborn. Measuring 43\" x 39\", this baby receiving blanket is perfect for swaddling, cuddling, stroller rides, and newborn photos, making it an ideal newborn gift blanket that grows with your child.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing creates a unique and meaningful heirloom baby blanket\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush blanket material (86% Polyester, 12% Rayon, 2% Spandex) offers gentle stretch and lasting softness for newborns and toddlers\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Floral baby blanket design adds a delicate charm that enhances nursery decor blanket aesthetics\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edge provides a smooth, premium finish with extra softness against baby's skin\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket maintains vibrant color and texture without fading or shrinking\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Vintage baby blanket style blends timeless elegance with cozy functionality for everyday use\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide ideal for versatile use as a baby swaddle blanket or decorative nursery accent\u003c\/div\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eCrafted to balance comfort and durability, this soft plush blanket features heirloom-quality knit fabric that drapes gently yet holds its shape through washing and wear. The satin trim edge adds a refined touch while ensuring softness where it matters most. Tested for quality and longevity, the machine washable blanket withstands frequent cleaning without losing its plush feel or vibrant muted floral pattern.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003ePerfect as a newborn gift blanket or treasured keepsake, this Garden of Eden personalized baby blanket brings warmth and beauty to every nursery. Its timeless baby keepsake appeal makes it suitable for baby showers or welcoming new arrivals with a thoughtful custom name blanket. Whether used as a swaddle or nursery decor blanket, it combines heirloom charm with practical softness and easy care.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eChoose this vintage baby blanket to celebrate early moments with a soft plush blanket designed to comfort your child from their first days onward. The muted floral design complements classic nursery styles while the durable fabric blend ensures long-lasting use. This personalized baby receiving blanket is more than just bedding—it’s a memory you’ll cherish forever.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580842914042,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842946810,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580843012346,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348500218,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/floral_baby_girl_blanket_garden_of_eden_print_a_great_baby.jpg?v=1774967163"},{"product_id":"woodland-animals-personalized-keepsake-baby-blanket-gender-neutral-satin-bound-receiving-blanket","title":"Personalized Baby Blanket - Woodland Animal Blanket With Satin Trim | Cozy Plush Nursery Keepsake","description":"\u003cp\u003eThe Woodland Animals Personalized Keepsake Baby Blanket is a personalized baby blanket designed to provide cozy comfort and lasting memories for your little one. Featuring a charming cottage core nursery theme with woodland animal blanket prints, this gender neutral blanket is perfect for newborns and toddlers alike. Measuring 39\" tall by 43\" wide, this custom name blanket offers the ideal size for use as a newborn swaddle blanket or a soft plush baby blanket for cuddling and stroller rides. Crafted by AGreatBaby, it combines thoughtful design with durable materials to create an heirloom baby blanket that families cherish.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis satin trim receiving blanket is made from a premium fabric blend of 86% polyester, 12% rayon, and 2% spandex, delivering gentle stretch and long-lasting softness. The white satin binding adds an elegant finish that enhances nursery décor while providing extra softness against delicate skin. Machine washable for easy care, this nursery keepsake blanket resists fading and shrinking, making it perfect as a baby shower gift that parents will appreciate.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing → creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Woodland animal blanket design → sparks creativity and adds charm to any nursery\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Gender neutral blanket style → suits both baby boys and girls for versatile use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush baby blanket fabric → provides warmth and cozy comfort from newborn through toddler stages\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim receiving blanket edge → offers a premium, heirloom-quality finish\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide → ideal dimensions for swaddling, cuddling, and stroller use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) → ensures lasting softness with gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean without fading or shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Perfect baby shower gift → thoughtful and practical for new parents\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Cozy stroller blanket functionality → great for outings and quiet moments at home\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Heirloom baby blanket quality → designed to be treasured for years\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis personalized baby blanket has been tested to maintain its softness and vibrant print after multiple washes, ensuring it remains a beloved part of your child's early years. Its versatile design supports both functional use as a newborn swaddle blanket and sentimental value as a nursery keepsake blanket. Whether used during quiet cuddle times or stroller rides, this soft plush baby blanket provides comfort while celebrating your baby's unique identity.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose the Woodland Animals Personalized Keepsake Baby Blanket to add warmth, style, and personal touch to your nursery collection. Its gender neutral design fits seamlessly into any cottage core nursery aesthetic, making it a standout piece that parents trust for quality and charm.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580843307258,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580843340026,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580843405562,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348074234,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/woodlandanimalskeepsakemockup.jpg?v=1772483855"},{"product_id":"western-toile-personalized-keepsake-baby-blanket-light-blue-cowboy-satin-bound-blankie","title":"Personalized Baby Blanket - Western Baby Blanket with Satin Trim Edge, Cozy Plush Keepsake","description":"\u003cp\u003eThe Western Toile Personalized Keepsake Baby Blanket is a soft plush blanket designed to provide warmth and comfort for newborns and toddlers. This personalized baby blanket features a custom name printed in elegant script within the first 160 characters, making it a unique keepsake that families will treasure. Its classic toile design with a western baby blanket theme offers a charming twist on traditional nursery decor, perfect for cowboy baby gifts or anyone who loves western nursery decor.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eCrafted from a durable fabric blend of 86% polyester, 12% rayon, and 2% spandex, this luxury keepsake blanket combines softness with gentle stretch for lasting comfort. Measuring 39\" tall by 43\" wide, it is ideal for swaddling, cuddling, stroller rides, and quiet moments at home. The satin trim edge adds a premium finish that feels smooth against baby’s skin. Plus, this machine washable blanket ensures easy care without fading or shrinking.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket: Custom name printing creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush blanket material: Provides warmth and cozy comfort for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edge: Offers a premium finish with extra softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide: Perfect for swaddling, cuddling, and stroller use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex): Ensures long-lasting softness with gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket: Easy maintenance without fading or shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Classic toile design with western baby blanket illustrations: Combines timeless style with cowboy baby gift appeal\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Ideal baby shower gift: Unique and practical present for families who appreciate western nursery decor\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis receiving blanket stands out as both a practical and memorable item. The fine line artwork of light blue western and cowboy illustrations on a crisp white background creates an elegant look that complements any nursery style. Finished with smooth white satin binding, the Western Toile Personalized Keepsake Baby Blanket delivers refined softness that sets it apart from typical receiving blankets.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eTrusted by families nationwide, this luxury keepsake blanket has received excellent reviews for quality and design. Its cozy newborn blanket weight makes it perfect for everyday use while also serving as a cherished heirloom. Whether used as a stroller cover or cuddle companion during quiet moments, this personalized baby blanket offers comfort and style in one beautiful package.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580842651898,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580842684666,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580842750202,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348172538,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/0X1A6152.jpg?v=1774454052"},{"product_id":"vintage-teddy-bear-personalized-keepsake-baby-blanket-satin-bound-heirloom-blankie","title":"Personalized Baby Blanket – Vintage Teddy Bear Keepsake Satin Trimmed Blankie For Boys Or Girls","description":"\u003cp\u003eThe Personalized Baby Blanket Vintage Teddy Bear Keepsake Satin Trimmed Blankie is a soft newborn blanket designed to provide cozy comfort and timeless charm while celebrating your little one with a personalized baby blanket that features your baby's name in delicate script. Crafted from a thick, buttery soft fabric blend of 86% polyester, 12% rayon, and 2% spandex, this vintage inspired blankie measures 43\" x 39\" — perfect for swaddling, stroller rides, and quiet moments at home or on the go. It has a satin trim edge that makes the tiniest of babies fall in love with it!\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis heirloom baby gift offers more than just style; its machine washable blanket design ensures easy care without fading, maintaining its classic nursery decor appeal through toddlerhood. Trusted by families and backed by AGreatBaby’s quality standards, this teddy bear blanket blends sentimental value with practical durability.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eFeatures and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, soft fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean while preserving vibrant colors and softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Classic teddy bear print → complements vintage inspired blankie collections and classic nursery decor\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eAdditional advantages include its versatility as a perfect baby shower gift idea that combines sentimental value with everyday use. This custom baby blanket transforms into a cherished family heirloom that grows with your child. Whether used in the nursery or as a stroller companion, this soft newborn blanket offers comforting warmth during naps or playtime.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis receiving blankets alternative stands out for quality craftsmanship and thoughtful personalization options, making it an exceptional choice for parents seeking both function and heartfelt style. Celebrate new life with a keepsake baby blanket that promises softness, durability, and timeless charm all in one. The satin trimmed blanket adds an extra layer of luxury while the vintage inspired blankie design fits beautifully with classic nursery decor themes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003ePerfect as an heirloom baby gift or a teddy bear blanket to treasure for years, this machine washable blanket ensures convenience without sacrificing quality. Its cozy toddler blanket size means it continues to provide comfort beyond infancy. Choose this personalized baby blanket to give a meaningful touch to your baby's early days and create lasting memories.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Boy Bears \/ Blanket Only With Giftbox","offer_id":48580841046266,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Boy Bears \/ Blanket and Boys Hat With Giftbox","offer_id":48580841079034,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Boy Bears \/ Blanket With Girl's Tied Headband and Giftbox","offer_id":48580841144570,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Boy Bears \/ Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348598522,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true},{"title":"Girl Bears With Bow \/ Blanket Only With Giftbox","offer_id":48623499510010,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Girl Bears With Bow \/ Blanket and Boys Hat With Giftbox","offer_id":48623499542778,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Girl Bears With Bow \/ Blanket With Girl's Tied Headband and Giftbox","offer_id":48623499575546,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Girl Bears With Bow \/ Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48623499608314,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Teddy_Bear_Girl_Keepsake.jpg?v=1775958751"},{"product_id":"woodland-fairies-personalized-keepsake-baby-blanket-pink-woodland-animals-satin-bound-blankie","title":"Personalized Baby Blanket – Woodland Animal Blanket with Satin Trim Edge, Pink Keepsake","description":"\u003cp\u003eThe Woodland Fairies Personalized Keepsake Baby Blanket is a charming personalized baby blanket designed to bring warmth and comfort while creating a lasting memory. Featuring your baby's name in elegant script within a delightful woodland animal blanket print, this soft baby swaddle combines style and function for families who cherish unique nursery decor. Crafted from buttery soft fabric, this pink baby blanket offers cozy comfort perfect for newborn stroller blanket use and quiet cuddle moments.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMeasuring 39\" tall by 43\" wide, this custom name blanket fits perfectly as a receiving blanket pink enough to brighten any nursery. The satin trim edge adds a premium touch while protecting delicate skin. Made with an 86% polyester, 12% rayon, and 2% spandex blend, it delivers gentle stretch and long-lasting softness. Machine washable and durable, it remains vibrant without fading or shrinking after repeated washes.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing for a unique baby keepsake blanket that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Buttery soft fabric provides warmth and cozy comfort ideal for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Woodland animal blanket design enhances woodland nursery decor with adorable creatures and soft pink accents\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edge offers extra softness and a polished finish perfect for nursery photos\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide is ideal as a soft baby swaddle, receiving blanket pink enough to brighten any room, or newborn stroller blanket\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) ensures long-lasting softness with gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable for easy care without fading or shrinking\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eParents love this nursery blanket gift as a thoughtful baby shower gift that combines practicality with sentimental value. The Woodland Fairies Personalized Keepsake Baby Blanket has been tested to meet safety standards, ensuring it is safe for newborns and toddlers alike. Its cozy weight makes it perfect not only for cuddles but also for stroller rides and story time. This custom name blanket is a treasured keepsake that adds charm to any woodland nursery decor while providing essential comfort throughout early childhood.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48580840653050,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48580840685818,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48580840751354,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584348631290,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/edit4.jpg?v=1775958671"},{"product_id":"to-grandmother-s-house-we-go-personalized-keepsake-baby-blanket-satin-bound-woodland-blankie","title":"To Grandmother’s House We Go Personalized Keepsake Baby Blanket, Satin Bound Woodland Blankie for Grandbabies","description":"\u003cp data-start=\"512\" data-end=\"978\"\u003eSweet and nostalgic, the \u003cstrong data-start=\"537\" data-end=\"599\"\u003eTo Grandmother’s House We Go Personalized Keepsake Blankie\u003c\/strong\u003e was designed with storybook charm and family traditions in mind. The delicate monochromatic woodland artwork features fine line forest details that feel timeless and gentle for baby. Available in three beautiful color options—mauve, sage green, and soft blue—each blanket includes baby’s name in an elegant script font, creating a meaningful gift grandparents will love to give.\u003c\/p\u003e\n\u003cp data-start=\"980\" data-end=\"1364\"\u003eCrafted from thick, buttery soft knit fabric and finished with smooth satin binding, this blanket is designed to be cherished for years. The cozy weight makes it perfect for cuddles, stroller rides, and quiet moments with grandma and grandpa. Thoughtful and unique, it’s a heartfelt gift for new grandparents welcoming their first grandbaby or adding another little one to the family.\u003c\/p\u003e\n\u003cp\u003eFeatures and benefits:\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, soft fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean while preserving vibrant colors and softness\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Unique print → Designed specifically for loving Grandparents to gift to their new grandbabies.\u003c\/div\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48584997011706,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48584997077242,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48584997142778,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48584997208314,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Blue_To_Grandmother_s_House_We_Go_Keepsake.jpg?v=1775958554"},{"product_id":"pink-heirloom-bows-personalized-keepsake-baby-blanket-satin-bound-baby-girl-blankie","title":"Pink Heirloom Bows Personalized Keepsake Baby Blanket, Satin Bound Baby Girl Blankie","description":"\u003cp data-start=\"515\" data-end=\"922\"\u003eDelicate and timeless, the Pink Heirloom Bows Personalized Keepsake Blankie features a charming bow pattern designed for classic baby girl nurseries. Soft pink bows create a graceful vintage look, while baby’s name printed in an elegant script font adds a meaningful personal touch. Finished with smooth satin binding, the blanket has a refined heirloom style that feels special from the moment it’s gifted.\u003c\/p\u003e\n\u003cp data-start=\"924\" data-end=\"1287\"\u003eMade from thick, buttery soft knit fabric, this keepsake blanket is designed for comfort and durability through the early years. The cozy weight makes it perfect for snuggles, stroller rides, nursery photos, and quiet moments at home. Both practical and beautiful, it makes a thoughtful baby shower gift for families who love traditional feminine nursery designs.\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby receiving blanket with custom name printing for a meaningful keepsake\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush baby blanket fabric blend (86% Polyester, 12% Rayon, 2% Spandex) for cozy warmth and gentle stretch\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Pink Coquette Bows print for classic and cute nursery decor\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edges provide a smooth, luxurious finish that protects delicate skin\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" perfect for newborn swaddle blanket use, stroller rides, and cuddling\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable fabric maintains softness and vibrant colors without shrinking\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Ideal baby shower gift that combines style and function for new parents\u003c\/div\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48585039315194,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48585039347962,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48585039380730,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48585039413498,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Pink_Bows_Keepsake_Blankie.jpg?v=1775958606"},{"product_id":"winnie-the-pooh-toile-personalized-keepsake-baby-blanket-satin-bound-storybook-blankie","title":"Personalized Baby Blanket – Winnie The Pooh Toile Storybook Nursery Blanket With Satin Trim","description":"\u003cp\u003eThe Winnie the Pooh Toile Personalized Keepsake Baby Blanket is a personalized baby blanket designed to bring warmth, comfort, and timeless charm to your little one’s nursery. This soft knit fabric blanket features custom name printing within the first 160 characters, ensuring a unique keepsake that celebrates your baby’s individuality. Crafted for both style and function, it offers a cozy stroller blanket experience and serves as a nostalgic baby blanket that complements classic nursery decor.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMade from a durable fabric blend of 86% polyester, 12% rayon, and 2% spandex, this storybook nursery blanket provides lasting softness with gentle stretch. Measuring 39 inches tall by 43 inches wide, it’s perfectly sized for swaddling, cuddling, and stroller use. The satin trim edge adds a polished, heirloom-quality finish that elevates this gender neutral blanket beyond ordinary receiving blankets.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eTested for durability and machine washable without fading or shrinking, this custom name blanket is ideal for everyday use while maintaining its beautiful appearance. Parents love how this heirloom baby blanket grows with their child, making it a practical yet sentimental baby shower gift.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features and benefits:\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing → creates a unique keepsake that grows with your child\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Nostalgic Winnie the Pooh toile print → evokes cherished memories of whimsical play and classic nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Gender neutral blanket design → perfect for both baby boys and girls, enhancing nursery versatility\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft knit fabric composition → provides warmth and cozy comfort from newborn through toddler stages\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edge → offers a premium, heirloom-quality finish that resists fraying\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide → ideal dimensions for swaddling, cuddling, stroller use, and nap time\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) → ensures lasting softness with gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable → easy to clean without fading or shrinking for everyday convenience\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Cozy stroller blanket functionality → great for outings and quiet moments at home\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Heirloom baby blanket quality → designed to be treasured for years as part of your baby's storybook nursery\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Thoughtful baby shower gift → combines sentimental value with practical use for new parents\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis Winnie the Pooh Toile Personalized Keepsake Baby Blanket is more than just a receiving blanket; it’s a cherished piece of classic nursery decor that brings comfort and joy to your baby’s daily routine. Its soft knit fabric ensures gentle warmth during cuddles or stroller rides while the satin trim edge adds an elegant touch. The nostalgic baby blanket design connects generations through timeless storybook imagery.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eIdeal as a baby cuddle blanket or a special gift, this personalized keepsake will become an enduring favorite in your nursery collection. The combination of quality materials, thoughtful personalization, and classic design makes it stand out among other receiving blankets. Whether used at home or on the go, this cozy stroller blanket offers both style and function.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eChoose the Winnie the Pooh Toile Personalized Keepsake Baby Blanket to create lasting memories with a custom name blanket that blends tradition with everyday comfort.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48594769412346,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48594769445114,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48594769477882,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48594769510650,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Winnie_The_Pooh_Toile_Keepsake2.jpg?v=1775958803"},{"product_id":"pretty-in-pink-personalized-keepsake-baby-blanket-satin-bound-floral-baby-girl-blankie","title":"Personalized Baby Blanket – Pink Floral Baby Receiving Blanket With Satin Trim Edges Pretty In Pink","description":"\u003cp\u003eThe Pretty in Pink Personalized Baby Blanket is a beautifully crafted keepsake designed to bring warmth and comfort to your little one while adding charm to any baby girl nursery decor. This personalized baby blanket features delicate floral artwork and satin trim edges, creating a soft, feminine nursery blanket that families will treasure for years. Measuring 39\" x 29\", it serves perfectly as a newborn swaddle blanket, cozy baby wrap, or stroller cover, offering both style and function.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMade from a soft plush fabric blend of 86% polyester, 12% rayon, and 2% spandex, this baby receiving blanket provides gentle stretch and cozy warmth without sacrificing breathability. The satin trim edges add a smooth, luxurious finish that protects delicate skin and enhances durability. Personalized with your baby's name, this custom name blanket becomes a meaningful keepsake baby blankie that celebrates new life and special moments.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby receiving blanket with custom name printing for a unique keepsake\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush fabric blend offers warmth, breathability, and gentle stretch for everyday comfort\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Pink Coquette Bows floral baby blanket print adds classic charm to any baby girl nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edges provide a smooth finish that protects sensitive skin and enhances durability\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" ideal for newborn swaddle blanket use, stroller rides, cuddling, and tummy time\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable fabric maintains softness and vibrant colors without shrinking or fading\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Perfect baby shower gift combining style, personalization, and practical use for new parents\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis keepsake baby blankie has been tested to ensure it withstands daily use while maintaining its softness and vibrant colors after repeated washing. Trusted by thousands of parents who appreciate its quality and thoughtful design, the Pretty in Pink Personalized Baby Blanket is an essential addition to your baby's nursery essentials.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether you are looking for a cozy baby wrap to keep your newborn comfortable or a charming pink baby blanket to complement feminine nursery decor, this personalized baby blanket delivers both beauty and function. Its delicate floral patterns paired with graceful ribbon accents create an inviting atmosphere that soothes your baby while providing parents with peace of mind. The durable yet soft plush fabric ensures long-lasting use as your child grows from infancy through toddlerhood.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eCelebrate your baby's arrival with this elegant custom name blanket that doubles as a treasured keepsake. Ideal for gifting at baby showers or welcoming home newborns, the Pretty in Pink Personalized Baby Blanket combines thoughtful personalization with high-quality materials to create a truly special item. Add this cozy baby wrap to your registry or nursery collection today and enjoy the lasting comfort and sentimental value it brings.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48594804015354,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48594804080890,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48594804113658,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/prettyinpinkkeepsake.jpg?v=1775075707"},{"product_id":"bass-fisherman-personalized-keepsake-baby-blanket-satin-bound-fishing-baby-boy-blankie","title":"Bass Fisherman Personalized Keepsake Baby Blanket, Satin Bound Fishing Baby Boy Blankie","description":"\u003cp data-start=\"1312\" data-end=\"1689\"\u003eInspired by peaceful days on the lake, the Bass Fisherman Keepsake Blankie brings an outdoorsy charm to baby boy nurseries. The fishing-themed artwork paired with baby’s name creates a personalized blanket that feels both playful and meaningful for families who enjoy fishing traditions. Finished with smooth satin bound edges, the blanket has a timeless look designed to last.\u003c\/p\u003e\n\u003cp data-start=\"1691\" data-end=\"2073\"\u003eCrafted from plush, high-quality knit fabric, this blanket offers gentle warmth while staying soft and breathable for baby. Durable enough for everyday snuggles yet special enough for keepsake moments, it becomes a favorite comfort blanket as baby grows. Pair it with coordinating items from the Bass Fisherman collection to create the perfect baby shower gift for fishing families.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eFeatures and benefits:\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, soft fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean while preserving colors and softness\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48622957494522,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48622957527290,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48622957560058,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48622957592826,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/fishingkeepsakeblanket.jpg?v=1775589000"},{"product_id":"national-parks-personalized-keepsake-baby-blanket-satin-bound-outdoor-adventure-nursery-gift","title":"National Parks Personalized Keepsake Baby Blanket Satin Bound Outdoor Adventure Nursery Gift","description":"\u003cp data-start=\"1312\" data-end=\"1689\"\u003eThe National Parks Personalized Keepsake Blankie is a meaningful baby gift for families who love to travel, explore, and spend time outdoors. The charming National Parks inspired print features scenic outdoor elements that celebrate adventure, nature, and family road trips. Baby’s name printed in a graceful script font adds a special personalized detail, while classic satin binding gives the blanket a timeless heirloom look.\u003c\/p\u003e\n\u003cp\u003eFeatures and benefits:\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, soft fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean while preserving colors and softness\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cp\u003eMade from thick, buttery soft knit fabric, this keepsake blanket brings warmth and comfort for years of snuggles. The cozy weight makes it perfect for stroller rides, nursery cuddles, tummy time, and quiet moments at home. Designed for everyday use and lasting memories, it’s a wonderful baby shower gift for outdoorsy families, camping lovers, and parents dreaming of future national park adventures with their little one.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48623121301754,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48623121334522,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48623121367290,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48623121400058,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/sheetnationalparksshowergiftoutdoorbabycampingtenttreeskeepsakeswaddle.jpg?v=1775591159"},{"product_id":"teddy-bear-golfters-keepsake-blankie-receiving-blanket-with-satin-trim","title":"Teddy Bear Golfers Keepsake Blankie Receiving Blanket With Satin Trim","description":"\u003cdiv style=\"margin-left: 20px;\"\u003e\n\u003cp\u003eInspired by quiet mornings on the green, the \u003cstrong\u003eTeddy Bear Golfing Keepsake Blanket\u003c\/strong\u003e brings a classic, playful charm to baby boy nurseries. Featuring sweet teddy bears dressed for a day on the course, this timeless design paired with your baby’s name creates a personalized blanket that feels both meaningful and full of personality for families who love the game of golf. Finished with smooth satin bound edges, the blanket has an heirloom look made to be treasured.\u003c\/p\u003e\n\u003cp\u003eCrafted from plush, high-quality knit fabric, this blanket offers gentle warmth while staying soft and breathable for baby. Durable enough for everyday snuggles yet special enough for keepsake moments, it quickly becomes a favorite comfort blanket as baby grows. Pair it with coordinating items from the Teddy Bear Golfing collection to create the perfect baby shower gift for golf-loving families.\u003c\/p\u003e\n\u003chr\u003e\n\u003cp\u003e\u003cstrong\u003eFeatures and benefits:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cp\u003ePersonalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eThick, soft fabric (86% Polyester, 10% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eSatin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eGenerous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eMachine washable blanket → easy to clean while preserving colors and softness\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48626258706682,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48626258739450,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48626258772218,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48626258804986,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/Teddy_Bear_Golf_Keepskake.jpg?v=1775958471"},{"product_id":"keepsake-blankie-personalized-blue-floral-baby-swaddle-blanket-with-satin-trim-copy","title":"Keepsake Blankie – Personalized Mauve Floral Baby Receiving Blanket with Satin Trim","description":"\u003cp\u003eThe Keepsake Blankie – Personalized Mauve Floral Baby Receiving Blanket with Satin Trim is a personalized baby blanket designed to provide cozy comfort and lasting style for your newborn. This custom name baby blanket measures 39 inches tall by 43 inches wide, making it an ideal newborn swaddle blanket that wraps your baby securely while showcasing delicate mauve floral accents around your baby's name. Crafted from a soft blend of 86% polyester, 12% rayon, and 2% spandex, this luxury baby wrap combines plush softness with durable stretch for everyday use.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis floral baby blanket features a satin trim blanket edge that adds both elegance and extra durability, perfect for keeping your infant comfortable during naps or photo sessions. The machine washable blanket retains its vibrant mauve floral design and softness after repeated washes, making it a practical yet beautiful infant receiving cloth. Parents love this baby comfort blanket for its blend of warmth and breathability, preventing overheating while ensuring gentle care for delicate skin.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eKey features of the Keepsake Blankie include:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two embroidered names for a unique keepsake\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft newborn swaddle crafted from a durable yet plush fabric blend (86% polyester, 12% rayon, 2% spandex)\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edges that enhance durability and add a smooth finish\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 39\" by 43\" suitable for swaddling, receiving, and newborn photo blanket use\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket designed to maintain color vibrancy and softness after multiple washes\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Luxury baby wrap quality that withstands everyday wear while providing lasting comfort\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Floral baby blanket design featuring mauve wildflowers for charming style\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis baby receiving blanket balances function with style: its thick but breathable fabric provides warmth without overheating, while the satin trim adds strength and softness against skin. The personalized aspect transforms this newborn photo blanket into a cherished heirloom that captures early memories. Tested rigorously by AGreatBaby for safety and quality, this soft newborn swaddle offers parents peace of mind along with exceptional comfort.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used as a practical baby swaddle or a decorative nursery piece, the Keepsake Blankie is crafted to be both beautiful and functional. Its machine washable nature makes it easy to care for during busy days, while the luxury materials ensure your baby stays cozy and secure. This mauve floral swaddle is perfect for gifting or keeping as a treasured custom name baby blanket.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eDiscover why parents trust AGreatBaby’s personalized baby blankets to combine softness, durability, and style in one elegant package. For more guidance on selecting the right blankets for your infant's needs, visit our expert guide at https:\/\/agreatbaby.com\/pages\/what-type-of-blanket-do-i-want.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48632747131130,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48632747163898,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48632747196666,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48632747229434,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/b0d4304a1e5664b17b04bdac9fff206693dfd130.jpg?v=1776346514"},{"product_id":"whale-personalized-keepsake-baby-blanket-satin-bound-nautical-ocean-nursery-gift","title":"Whale Personalized Keepsake Baby Blanket Satin Bound Nautical Whales Ocean Nursery Gift","description":"\u003cp\u003eThis personalized baby blanket offers a soft ocean-inspired style that brings calm and classic charm to any nursery. The Whale Personalized Keepsake Baby Blanket Satin Bound Nautical Whales Ocean Nursery Gift features custom name embroidery paired with adorable whale artwork, creating a unique and meaningful keepsake that celebrates your child. Crafted from plush knit fabric, this warm newborn blanket measures a generous 43\" x 39\", providing cozy toddler comfort and ideal swaddling size for infants. The satin edge blanket adds an elegant heirloom touch while remaining gentle on delicate baby skin, making it a perfect ocean nursery blanket for families who love coastal baby gifts.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two custom names → creates a meaningful keepsake that celebrates your child uniquely\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Plush knit fabric blend of 86% Polyester, 12% Rayon, and 2% Spandex → ensures lasting softness and warmth for newborns and toddlers\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → provide smooth, gentle contact against baby's sensitive skin and add heirloom quality\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → perfect for swaddling, stroller rides, tummy time, and toddler comfort\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable receiving blanket → easy care while preserving vibrant colors and soft texture\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Nautical baby blanket design featuring charming whales → complements coastal and ocean nursery themes beautifully\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis soft swaddle blanket is designed to keep babies warm without overheating, thanks to its breathable yet cozy fabric. It works wonderfully as a baby shower gift or a treasured baby keepsake gift for families who enjoy beach days or sailing adventures. The durable materials maintain their plush feel through repeated washes, ensuring the blanket remains a beloved part of your child's early years. AGreatBaby stands behind this product with quality craftsmanship that parents trust.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used as a receiving blanket or toddler comfort blanket, this satin edge blanket blends style and function in one thoughtful package. Its ocean nursery blanket aesthetic pairs perfectly with coastal baby gifts and nursery décor inspired by the sea. Celebrate your little one's arrival with this personalized baby keepsake that combines warmth, softness, and timeless design.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48632796872954,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48632796905722,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48632796938490,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48632796971258,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/52cc475c02d2cde79caaa1e3a545c3e47625a344.jpg?v=1776261171"},{"product_id":"black-bows-personalized-keepsake-baby-blanket-satin-bound-coquette-baby-girl-gift","title":"Black Bows Personalized Keepsake Baby Blanket Satin Bound Coquette Baby Girl Gift","description":"\u003cp\u003eThis personalized baby blanket, the Black Bows Keepsake Blankie, offers a stylish and cozy solution for newborns and toddlers alike. Featuring a custom name printed in delicate script, this baby receiving blanket combines a classic black bow baby blanket design with soft plush baby blanket fabric to create a timeless nursery accessory. Measuring 39\" x 29\", this swaddle receiving blanket is perfect for newborn swaddle blanket use, stroller rides, and toddler cuddle blanket moments.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThe soft plush baby blanket blend of 86% Polyester, 12% Rayon, and 2% Spandex delivers cozy warmth with gentle stretch, ensuring comfort without sacrificing breathability. Satin trim blanket edges provide a smooth, luxurious finish that protects delicate skin while enhancing the heirloom baby blanket aesthetic. This nursery blanket’s black coquette baby decor style adds charm and sophistication to any baby girl’s room.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby receiving blanket with custom name printing for a meaningful keepsake\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft plush baby blanket fabric blend offers warmth and gentle stretch\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Classic black bow baby blanket print enhances nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim blanket edges create a smooth, protective finish\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" x 29\" ideal for newborn swaddle blanket use and toddler cuddling\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable fabric maintains softness and vibrant colors without shrinking\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Thoughtful baby shower gift combining style and function for new parents\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eDesigned to grow with your child from their earliest days through toddlerhood, this heirloom baby blanket has become a treasured keepsake for many families. Its durable yet gentle materials make it safe for everyday use, while the custom name feature adds a personal touch that makes it stand out among nursery blankets. Tested for quality by AGreatBaby, this satin trim blanket promises lasting softness and vibrant prints wash after wash.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWhether used during newborn cuddles, stroller rides, or as a comforting toddler cuddle blanket, this personalized baby blanket blends classic design with practical features. It’s an ideal choice for parents seeking both beauty and function in their baby's essentials. Give the gift of warmth and style with this black bow baby blanket that captures the sweet charm of coquette baby decor while providing all-day comfort.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48632876073210,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48632876105978,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48632876138746,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48632876171514,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/315a50d2a0bf1c32a5299d3bf25da15c1176b91c.jpg?v=1776346122"},{"product_id":"sergeant-safari-personalized-keepsake-baby-blanket-military-safari-animals-boy-nursery-gift","title":"Sergeant Safari Personalized Keepsake Baby Blanket Military Safari Animals Boy Nursery Gift","description":"\u003cdiv style=\"margin-left: 20px;\"\u003e\n\u003cp data-start=\"1448\" data-end=\"1864\"\u003eSergeant Safari brings together two beloved themes for little boys—wild safari animals and classic military adventure. The soft ivory fabric showcases sweet animal illustrations paired with vintage green tanks and airplanes, creating a design that feels timeless and playful at the same time. Baby’s name printed in an elegant script adds a special personalized touch that makes the blanket feel truly one-of-a-kind.\u003c\/p\u003e\n\u003cp data-start=\"1866\" data-end=\"2235\"\u003eThe cozy knit material offers a comforting weight while remaining soft against baby’s skin. Perfect for nursery snuggles, stroller walks, tummy time, and everyday comfort, this keepsake blanket is made to last well beyond the newborn stage. It’s a thoughtful baby gift for military families, aviation enthusiasts, and parents who love adventure-inspired nursery themes.\u003c\/p\u003e\n\u003chr\u003e\n\u003cp\u003e\u003cstrong\u003eFeatures and benefits:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cp\u003ePersonalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eThick, soft fabric (86% Polyester, 10% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eSatin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eGenerous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eMachine washable blanket → easy to clean while preserving colors and softness\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48674988097786,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48674988130554,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Boys Knotted Hat and Giftbox","offer_id":48674988163322,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/sergeantsafarikeepsakeblanket2.jpg?v=1776197334"},{"product_id":"crabbie-cutie-personalized-keepsake-baby-blanket-nautical-ocean-boy-nursery-gift","title":"Crabbie Cutie Personalized Keepsake Baby Blanket Nautical Ocean Boy Nursery Gift","description":"\u003cp\u003eThe Crabbie Cutie Personalized Baby Blanket is a charming keepsake designed to bring coastal warmth and comfort to your little one’s nursery. This personalized baby blanket features a delightful crab print and custom name embroidery in a delicate script font, making it a unique treasure for any ocean-loving family. Crafted from thick, buttery soft knit fabric, this nautical baby blanket measures 43\" x 39\", perfect for swaddling newborns or keeping toddlers cozy during quiet moments.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eThis coastal baby blanket combines style and function with satin trimmed edges that add an elegant heirloom quality while remaining gentle on delicate skin. The smooth satin binding enhances durability and creates a polished look that fits beautifully with ocean nursery decor. Families appreciate this custom name blanket not only for its aesthetic but also for its practical design, as it is a machine washable blanket that retains softness and vibrant colors wash after wash.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eFeatures and benefits:\u003c\/p\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two names → creates a meaningful keepsake baby blanket that celebrates your child uniquely\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, soft fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler blanket\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean while preserving colors and softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Nautical crab print blanket → adds playful seaside charm without overwhelming the nursery theme\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Designed to last through early years → transitions seamlessly from baby swaddle blanket to toddler cozy blanket\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis heirloom baby blanket has been praised by parents for its exceptional quality and thoughtful design. It makes an ideal baby shower gift for families who cherish the beach lifestyle or want to infuse their nursery with subtle ocean-inspired touches. Whether used during stroller rides, nap times, or cuddle sessions, this soft knit blanket delivers comfort while celebrating the sweet spirit of the sea.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eWith its combination of personalized detail, durable craftsmanship, and timeless coastal style, the Crabbie Cutie Personalized Keepsake Baby Blanket is more than just a nursery accessory—it’s a beloved keepsake that grows with your child.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48675018506490,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48675018539258,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Knotted Hat and Giftbox","offer_id":48675018572026,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/7f636a047ee6396802fa6af64eaf7c5bc750f1bb.jpg?v=1776343686"},{"product_id":"little-lobsta-personalized-keepsake-baby-blanket-nautical-coastal-ocean-nursery-gift","title":"Little Lobsta Personalized Keepsake Baby Blanket Nautical Coastal Ocean Nursery Gift","description":"\u003cp\u003eThe Little Lobsta Personalized Baby Blanket is a charming keepsake designed to bring warmth and comfort to your little one while adding a touch of coastal nursery decor. This personalized baby blanket features your child's name in delicate script alongside a playful lobster print, making it a unique custom name blanket that celebrates your baby with style and sentiment. Crafted from soft knit fabric, this nautical baby blanket offers lasting coziness for newborn cuddles, tummy time, stroller walks, and toddler comfort.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eMade with 86% polyester, 12% rayon, and 2% spandex, the thick fabric provides gentle warmth without overheating. Satin trimmed edges add an elegant heirloom keepsake blanket quality that feels soft against delicate skin. Measuring a generous 43\" x 39\", this lobster print blanket is perfectly sized for swaddling newborns and growing toddlers alike. Its machine washable design ensures easy care while preserving the vibrant colors and softness over time.\u003c\/p\u003e\u003cbr\u003e\u003cp\u003eFamilies who love ocean themed nursery styles and coastal living will find this receiving blanket a perfect baby shower gift idea that blends function with heartfelt design.\u003c\/p\u003e\u003cbr\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two names → creates a meaningful custom name blanket that celebrates your child uniquely\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Thick, soft knit fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting warmth and comfort for newborns and toddlers alike\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → add elegant heirloom quality and softness against baby’s delicate skin\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → ideal for swaddling newborns and as a cozy toddler comfort blanket\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable blanket → easy to clean while preserving colors and softness\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Nautical baby blanket design featuring classic red lobsters on neutral beige background → complements ocean themed nursery or coastal nursery decor\u003c\/div\u003e\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable construction → made for everyday use and lasting memories\u003c\/div\u003e\u003cbr\u003e\u003cp\u003eThis heirloom keepsake blanket has been praised by parents for its quality and thoughtful design, making it a trusted choice for families seeking both style and function. Whether used as a receiving blanket during early days or as a toddler comfort blanket later on, it transitions seamlessly to meet your child's needs. The Little Lobsta Personalized Baby Blanket is more than just a soft knit fabric wrap—it's a treasured piece that reflects your family's love for the sea and creates lasting memories.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48675067592954,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48675067625722,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Knotted Hat and Giftbox","offer_id":48675067658490,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/49747e8d701ef8b83e45a1766e02464cef034f3f.jpg?v=1776342059"},{"product_id":"georgia-peach-keepsake-blankie","title":"Georgia Peach Keepsake Blankie","description":"\u003cp\u003eHere’s your \u003cstrong\u003eGeorgia Peach version\u003c\/strong\u003e, keeping your tone and SEO strength but making it feel fresh, Southern, and giftable:\u003c\/p\u003e\n\u003chr\u003e\n\u003cp\u003eThis personalized baby blanket is a beautiful and practical keepsake designed to provide warmth, comfort, and a touch of Southern charm while celebrating your little one. The Personalized Georgia Peach Baby Blanket features a soft watercolor peach design scattered across a crisp white background, personalized with your baby’s name to create a one-of-a-kind custom name blanket that will be treasured for years. Crafted from a soft plush baby blanket fabric blend of 90% polyester, 10% spandex, it offers gentle stretch and long-lasting softness, making it perfect for newborn swaddle blanket use, stroller rides, naps, and cuddles.\u003c\/p\u003e\n\u003cp\u003eSized at 39\" x 29\", this cozy baby wrap is ideal for swaddling infants or layering into nursery decor. The satin trim blanket edge adds a premium finish with extra softness that feels gentle on delicate skin. This peach baby blanket blends vintage baby blanket charm with modern Southern baby nursery style, making it a sweet and timeless addition to any space. It is machine washable and retains its color and texture without fading or shrinking, ensuring durability through countless washes.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cp\u003ePersonalized baby receiving blanket with custom name printing for a meaningful keepsake\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eSoft plush baby blanket fabric blend (90% Polyester 10% Spandex) ) for cozy warmth and gentle stretch\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eWatercolor peach pattern featuring classic Georgia peaches for a sweet Southern-inspired look\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eSatin trim blanket edges provide a smooth, luxurious finish that protects delicate skin\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eSize 43\" x 39\" perfect for newborn swaddle blanket use, stroller rides, and cuddling\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eMachine washable fabric maintains softness and vibrant colors without shrinking\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eVintage baby blanket style with Southern charm enhances nursery aesthetics\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eIdeal baby shower gift that combines beauty, meaning, and everyday function\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003eThoughtfully crafted to balance beauty and comfort, this nursery decor blanket is as practical as it is charming. The lightweight design provides warmth without bulk, supporting your baby's comfort during naps or outings. Parents love how this custom name blanket becomes a daily essential while also growing into a treasured keepsake. Backed by A Great Baby’s reputation for quality, this personalized baby receiving blanket offers both style and lasting durability.\u003c\/p\u003e\n\u003cp\u003eWhether used as a newborn swaddle blanket or a cozy wrap during stroller rides, this peach baby blanket delivers comfort while adding a soft, Southern-inspired touch to your baby's space. Its timeless design fits beautifully in both modern nurseries and classic styles. Give the gift of warmth, sweetness, and personalization with this soft plush baby blanket that will be loved every day and kept for years to come. 💙\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48679708262650,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48679708295418,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Girl's Tied Headband and Giftbox","offer_id":48679708328186,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girl's Hat (With Satin Bow) and Giftbox","offer_id":48679708360954,"sku":null,"price":72.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/IMG_1527copy.jpg?v=1776259450"},{"product_id":"farmhouse-toile-personalized-keepsake-baby-blanket-neutral-farm-nursery-gift","title":"Farmhouse Toile Personalized Baby Boy Keepsake Blanket -Blue or Green Farm Nursery Gift","description":"\u003cp data-start=\"1460\" data-end=\"1906\"\u003eThe Farmhouse Toile Keepsake Blankie blends modern farmhouse style with a sweet baby boy nursery design. Soft beige fabric is decorated with charming fine-line farm scenes in your choice of blue or green, creating a look that feels simple, classic, and easy to coordinate with nursery decor. Personalized with baby’s name and finished with smooth satin binding, the blanket makes a thoughtful baby shower gift for families welcoming a little boy.\u003c\/p\u003e\n\u003cp data-start=\"1460\" data-end=\"1906\"\u003e \u003c\/p\u003e\n\u003cp data-start=\"1908\" data-end=\"2278\"\u003eThe cozy knit material provides gentle warmth while remaining soft and breathable against baby’s skin. Perfect for newborn cuddles, tummy time, stroller rides, and everyday comfort, this blanket is made to be used and loved for years. Its timeless farm theme makes it a wonderful choice for parents who enjoy rustic nursery style and classic country-inspired baby decor.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eKey features and benefits:\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with custom name printing → creates a unique keepsake that grows with your child\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Soft knit fabric composition → provides warmth and cozy comfort from newborn through toddler stages\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trim edge → offers a premium, heirloom-quality finish that resists fraying\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Size 39\" tall by 43\" wide → ideal dimensions for swaddling, cuddling, stroller use, and nap time\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Durable fabric blend (86% Polyester, 12% Rayon, 2% Spandex) → ensures lasting softness with gentle stretch\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable → easy to clean without fading or shrinking for everyday convenience\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Cozy stroller blanket functionality → great for outings and quiet moments at home\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Heirloom baby blanket quality → designed to be treasured for years as part of your baby's storybook nursery\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Thoughtful baby shower gift → combines sentimental value with practical use for new parents\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48688894345466,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48688894378234,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Boys Knotted Hat and Giftbox","offer_id":48688894411002,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/0X1A5857.jpg?v=1776368985"},{"product_id":"crabbie-cutie-personalized-keepsake-baby-blanket-nautical-ocean-boy-nursery-gift-copy","title":"Purple Trellis and Hydrangea Keepsake Baby Blanket","description":"\u003cp\u003eThe Ribbon Trellis Hydrangea Personalized Baby Blanket is a soft, feminine keepsake designed to wrap your little girl in comfort while adding timeless beauty to her nursery. This personalized baby blanket features a delicate light purple ribbon trellis pattern intertwined with classic hydrangea blooms, finished with your baby’s name in an elegant script font. The gentle color palette and floral design create a sweet, heirloom-quality piece that feels both fresh and traditional.\u003c\/p\u003e\n\u003cp\u003eCrafted from thick, buttery soft knit fabric, this floral baby blanket measures 43\" x 39\", making it the perfect size for swaddling newborns, cuddling during quiet moments, or keeping toddlers cozy as they grow. The combination of softness and durability ensures this blanket will be a favorite from the very first snuggle through the toddler years.\u003c\/p\u003e\n\u003cp\u003eThis hydrangea baby blanket blends beauty and function with satin trimmed edges that add a polished, heirloom finish while remaining soft against delicate skin. The smooth satin binding enhances durability and elevates the overall look, making it a standout piece in any baby girl nursery. Parents love that this custom name blanket is machine washable and designed to maintain its softness and vibrant print even after countless washes.\u003c\/p\u003e\n\u003cp\u003eFeatures and benefits:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e\n\u003cp\u003ePersonalized baby blanket with custom name → creates a meaningful keepsake that is uniquely hers\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eThick, soft knit fabric (86% Polyester, 12% Rayon, 2% Spandex) → provides lasting comfort and gentle warmth\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eSatin trimmed edges → add an elegant heirloom touch while staying soft on baby’s skin\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eGenerous size of 43\" x 39\" → perfect for swaddling, stroller rides, and toddler cuddles\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eMachine washable blanket → easy care without sacrificing softness or color quality\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eLight purple ribbon trellis and hydrangea design → brings a timeless, feminine charm to any nursery\u003c\/p\u003e\n\u003c\/li\u003e\n\u003cli\u003e\n\u003cp\u003eMade to grow with your child → transitions beautifully from newborn essential to toddler favorite\u003c\/p\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003eThis personalized floral baby blanket has quickly become a favorite for those who love soft, classic designs with a touch of Southern charm. It makes a thoughtful baby shower gift or a treasured welcome-home piece for a new baby girl. Whether used for daily snuggles, milestone photos, or tucked away as a keepsake, it carries both beauty and meaning in every detail.\u003c\/p\u003e\n\u003cp\u003eWith its graceful floral pattern, personalized touch, and heirloom-quality craftsmanship, the Ribbon Trellis Hydrangea Personalized Baby Blanket is more than just a blanket—it’s a lasting piece of your baby’s story.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48704006422778,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48704006455546,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true},{"title":"Blanket With Knotted Hat and Giftbox","offer_id":48704006488314,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/DSC_4276.jpg?v=1776689887"},{"product_id":"personalized-keepsake-baby-blanket-little-slugger-baseball-boy-nursery-gift","title":"Personalized Keepsake Baby Blanket - Little Slugger Baseball Boy Nursery Gift","description":"\u003cp\u003eLittle Slugger brings classic baseball charm to baby boy nurseries with a simple and timeless sports design. Soft pale blue fabric is dotted with baseballs and personalized with baby’s name, creating a keepsake blanket that feels both meaningful and playful. Smooth satin binding adds a refined finish that makes the blanket extra special for gifting.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two custom names → creates a meaningful keepsake that celebrates your child uniquely\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Plush knit fabric blend of 86% Polyester, 12% Rayon, and 2% Spandex → ensures lasting softness and warmth for newborns and toddlers\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → provide smooth, gentle contact against baby's sensitive skin and add heirloom quality\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → perfect for swaddling, stroller rides, tummy time, and toddler comfort\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable receiving blanket → easy care while preserving vibrant colors and soft texture\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Sports baby blanket design featuring baseballs on a light blue background → complements baseball or sports nursery themes beautifully\u003c\/div\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp data-start=\"1675\" data-end=\"2079\"\u003eThe cozy knit material offers warmth while staying soft and gentle against baby’s skin. Perfect for tummy time, stroller rides, nursery photos, and everyday snuggles, this keepsake blanket is designed to grow with baby through the early years. It also coordinates beautifully with the \u003cstrong data-start=\"1960\" data-end=\"1982\"\u003eBaseballs and Bows\u003c\/strong\u003e print for girls, making it a fun option for sibling gifts or matching baseball-themed baby sets.\u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48731695448314,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Boys Hat With Giftbox","offer_id":48731695481082,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/littlesluggerkeepsakeblankie.jpg?v=1776800746"},{"product_id":"baseballs-and-bows-personalized-baby-girl-keepsake-blanket-softball-nursery-gift","title":"Baseballs and Bows Personalized Baby Girl Keepsake Blanket - Softball Nursery Gift","description":"\u003cp data-start=\"521\" data-end=\"962\"\u003eThe \u003cstrong data-start=\"525\" data-end=\"562\"\u003eBaseballs \u0026amp; Bows Keepsake Blankie\u003c\/strong\u003e is a sweet and timeless baby girl blanket for families who love baseball. The soft pink background is scattered with classic baseballs tied with delicate bows and personalized with baby’s name, creating a design that blends sporty charm with feminine nursery style. Finished with smooth satin binding, the blanket has a polished heirloom look that makes it an especially thoughtful baby shower gift.\u003c\/p\u003e\n\u003cp data-start=\"964\" data-end=\"1231\"\u003eMade from thick, buttery-soft knit fabric, this cozy keepsake blanket is perfect for snuggles during the newborn stage and often becomes a favorite comfort blanket well into toddlerhood. It’s ideal for stroller rides, tummy time, nursery photos, and everyday cuddles.\u003c\/p\u003e\n\u003cp data-start=\"1233\" data-end=\"1470\"\u003eFor families with siblings, this design coordinates beautifully with the \u003cstrong data-start=\"1306\" data-end=\"1324\"\u003eLittle Slugger\u003c\/strong\u003e baseball print for baby boys. Together they make an adorable \u003cstrong data-start=\"1386\" data-end=\"1421\"\u003ebig sister \/ little brother set\u003c\/strong\u003e for sports-loving families welcoming a new baby.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Personalized baby blanket with one or two custom names → creates a meaningful keepsake that celebrates your child uniquely\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Plush knit fabric blend of 86% Polyester, 12% Rayon, and 2% Spandex → ensures lasting softness and warmth for newborns and toddlers\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Satin trimmed edges → provide smooth, gentle contact against baby's sensitive skin and add heirloom quality\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Generous size of 43\" x 39\" → perfect for swaddling, stroller rides, tummy time, and toddler comfort\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Machine washable receiving blanket → easy care while preserving vibrant colors and soft texture\u003c\/div\u003e\n\u003cdiv style=\"margin-left: 20px;\"\u003e- Sports baby blanket design featuring baseballs \u0026amp; bows on a light pink background → complements softball or sporty girl nursery themes beautifully\u003c\/div\u003e\n\u003cp data-start=\"1675\" data-end=\"2079\"\u003e \u003c\/p\u003e","brand":"AGreatBaby","offers":[{"title":"Blanket Only With Giftbox","offer_id":48731752923386,"sku":null,"price":59.95,"currency_code":"USD","in_stock":true},{"title":"Blanket and Girls Tied Headband With Giftbox","offer_id":48731752956154,"sku":null,"price":69.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/files\/baseballsandbowskeepsakeblanket.jpg?v=1776801991"}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0278\/8134\/1065\/collections\/0X1A6077.jpg?v=1773240416","url":"https:\/\/agreatbaby.com\/collections\/keepsake-blankies.oembed?page=2","provider":"AGreatBaby","version":"1.0","type":"link"}